KEGG   Thermus thermophilus HB27: TTC1143Help
Entry
TTC1143           CDS       T00170                                 

Gene name
hemD
Definition
uroporphyrinogen-III synthase hemD
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
tth  Thermus thermophilus HB27
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:tth00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1112295..1112972)
Genome map
AA seq 225 aa AA seqDB search
MLLTRGKDRALLARLAALGIEAAEVALLEQVDLPARALLSEKLKEGWDYVAVTSKEGAKR
LLLAWEEAGRPFLRVAAVGEGTAGVLRAGGLPPAFLPPRATAKDLAQSFPQAQRVLFVAG
DLAGRDLEEGLRARGVEVVRLPVYATRERALAPEEVALLERAEVVAFFSPSGVRAFARWT
AKRPKAAAIGPSTGEEARRLGFPVVEAESPGLEGLFAALLRALGR
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
gtgctcctcacgagggggaaggatagggcgctccttgcgaggctcgccgccctcgggata
gaggcggcggaggtggcccttttggagcaggtggaccttcccgcccgcgccctcctctcc
gaaaagctcaaggaggggtgggactacgtggccgtgacctccaaggagggggcgaagcgc
ctcctccttgcctgggaggaggcgggccgccccttcctaagggtggcggccgtgggggag
ggcacggcgggggtcctgagggcaggggggcttcccccggccttcctgcccccacgggcc
acggccaaggacctggcccaaagctttccccaggcgcaaagggtcctcttcgtggccggg
gacctggcggggcgggacctggaggaagggcttagggcgcggggggtggaggtggtgcgc
cttccggtctacgccacccgggaaagggccctcgcccccgaggaggtggccctcttggag
cgggcggaggtggtggccttcttcagcccgagcggggtgcgggcctttgcccgctggacc
gctaagcgccccaaggcggccgccatcggcccgagcaccggggaggaggcccggaggctt
ggctttcccgtggtggaggcggaaagcccggggctagaagggctttttgccgcccttctc
cgggccctcgggcggtag

DBGET integrated database retrieval system