KEGG   Thermus thermophilus HB27: TTC1236Help
Entry
TTC1236           CDS       T00170                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
tth  Thermus thermophilus HB27
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:tth00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    TTC1236 (recR)
DNA repair and recombination proteins [BR:tth03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      TTC1236 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1198960..1199544
Genome map
AA seq 194 aa AA seqDB search
MRYPESLLKLTRALSRLPGIGPKTAQRLALHLAFHKEEAEALAEALEGLKRVRACRECGN
LAEGELCPICQDEDRDRSLLAVVESVADLYALERSGEFRGLYHVLGGALNPLEGIGPKEL
NLEGLFRRLEGVEEVVLATSMTVEGEATALYLAEELKKRGVRVTRPAYGLPVGGSLEYAD
EVTLGRALEGRRPV
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgcgctacccggaaagcctcctcaagctcacccgggccctctcccgcctccccggcatc
ggccccaagacggcccagcgcctggccctccacctcgccttccacaaggaggaggccgag
gccctggcggaggccctggaggggctcaagcgggtccgggcctgccgcgagtgcggcaac
ctggccgagggggagctctgccccatctgccaggacgaggaccgggaccgctccctcctc
gccgtggtggagagcgtggccgacctgtacgccctggagcggagcggggagttccggggc
ctctaccacgtcctgggaggggccttgaaccccctggagggcatcggccccaaggagctc
aacctggagggcctcttccggcggctggaaggcgtggaggaggtggtcctcgccacctcc
atgaccgtggagggggaggccaccgccctctacctcgccgaggagctgaagaagcggggg
gtgcgggtgacccggcccgcctacggcctccccgtgggggggagcctggagtacgccgac
gaggtgaccctgggccgggccctggaggggaggcggcccgtctag

DBGET integrated database retrieval system