KEGG   Thermus thermophilus HB27: TTC1341Help
Entry
TTC1341           CDS       T00170                                 

Definition
carboxylesterase (EC:3.1.1.1)
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
tth  Thermus thermophilus HB27
Brite
Enzymes [BR:tth01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     TTC1341
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1276177..1276869
Genome map
AA seq 230 aa AA seqDB search
MHLLLLHGFTSHPVLTLGPLPERLKEAGWEVRQPALPGHGTRPEDLLKVRFQDWLLAAEE
AYLELPEPRGVVGLSMGGLLAAHLAARHPTKALVALAPAFALKNPLAPLAPYLHWLIPRF
PGPPSIEDPELRKRNPNYPYFPTRAVLELLALMRKTPEVLPQVKARALVVEAGKDRVVKG
VDRYFALLGSPRKDYLVFPESGHDLLLDRDREAVARAVRDWLLASDNYLQ
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgcaccttctcctcctccacggcttcacttcccaccccgtcctcaccctcggccccctg
ccggaaaggcttaaggaggcggggtgggaggtgcgccagcccgccctgccgggccacggc
acgcggcccgaggacctcctaaaggtgcgctttcaggactggctcctggcggcggaggag
gcctacctggagcttcccgagccccggggggtggtggggctttccatgggggggcttctc
gccgcccacctcgccgcccgccaccccacaaaggccctcgtggccctggcccccgccttc
gccctgaaaaaccccttggcgcccctggcgccctacctccactggctcatcccccgcttt
cccggcccgccctccatagaggacccggagctcaggaagcgcaaccccaactacccctac
ttccccacccgggccgtcctggagctcctcgccctcatgcgcaaaaccccggaggtcctc
ccccaggtaaaggcccgggccctggtggtggaggcggggaaagaccgggtggtgaagggg
gtggaccggtacttcgccctcctgggaagcccgaggaaggactacctcgtcttcccggaa
agcggccacgacctcctcctggaccgggaccgggaggcggtggcccgggcggtgcgcgac
tggcttcttgcaagtgataactacttgcaataa

DBGET integrated database retrieval system