KEGG   Thermus thermophilus HB27: TTC1485Help
Entry
TTC1485           CDS       T00170                                 

Definition
isocitrate lyase (EC:4.1.3.1)
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
tth  Thermus thermophilus HB27
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:tth01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:tth00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1408014..1409321
Genome map
AA seq 435 aa AA seqDB search
MEGLTPEMQREAEALRREWETNPRWKGVRRDYRPEDVVRLRPSVMVEYTLAKRGAEKLWK
LLHERPYVHTFGAYTGAMAVEMVRAGLEAIYLSGWQVAADANLAWQTYPDQSLYPYNSVP
QIVKRINNALMRADQVERIEGRVTRDWYVPIVADAEAGFGGALNVFELTKAMIEAGAAGI
HYEDQLASEKKCGHLGGKVLVPTGQHIRTLQAARLAADVMGVPTVIIARTDAEAATLITS
DIDERDKPFILPDERTPEGFYRFKNGIEAGIARALAYAPYADVIWMETSKPDLEEARKFA
EAVKKEFPDKLLAYNLSPSFNWKKFLDDETIAKFNRELGEMGYKFQFITLAGWHALNYYI
WELAKGYKERGMPAFVELQQKEFAAQKEGFTAVKHQREVGAGYFDEVVLALTQGQASTLA
LKGSTEEAQFNEPVH
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atggaagggctgacccccgagatgcaaagggaagcggaggcgctccgccgggagtgggag
acaaacccgaggtggaagggcgtccggcgggactaccgccccgaggacgtggtgcgctta
aggcccagcgtgatggtggagtacaccctggccaagcgaggggcggagaaactctggaag
ctcctccacgaaaggccctacgtgcacaccttcggggcctacaccggggccatggcggtg
gagatggtgcgggccgggctggaggccatctacctctccggctggcaggtggccgccgac
gccaacctggcctggcagacctaccccgaccagtccctctatccctacaactccgtgccc
cagatcgtgaagcgcatcaacaacgccctcatgcgggccgaccaggtggagcggattgaa
ggccgggtgacccgggactggtacgtgcccatcgtggccgacgccgaggcgggcttcggc
ggggccctcaacgtgtttgagctcaccaaggccatgattgaggcaggggccgccgggatc
cactacgaggaccagctcgccagcgagaagaagtgcggccacctgggcggcaaggtcctg
gtgcccacgggccagcacatccgcaccctccaggcggccaggctcgccgcggacgtgatg
ggcgtgcccacggtgatcatcgcccgcaccgacgccgaggccgccaccctcatcaccagc
gacattgacgagcgggacaagcccttcatcctcccggacgagcgcacacccgagggcttc
taccgcttcaagaacgggattgaggccggcatcgcccgggccctggcctacgccccctac
gccgacgtgatctggatggagacctccaagcccgacctggaggaggcccggaagttcgcc
gaggcggtgaagaaggagttccccgacaagctcctcgcctacaacctctccccctccttc
aactggaaaaagttcctggacgacgagaccatcgccaagttcaaccgggagctcggggag
atggggtacaagttccagttcatcaccctggcgggctggcacgccctgaactactacatc
tgggagctggccaagggctacaaggagcggggcatgcccgccttcgtggagctccagcag
aaggagttcgccgcccagaaggagggcttcaccgccgtcaagcaccagcgggaggtgggg
gccgggtactttgacgaggtggtcctggccctgacccaggggcaggcctccaccctggcc
ctcaagggctccacggaagaggcccagttcaacgagcccgtccactga

DBGET integrated database retrieval system