KEGG   Thermus thermophilus HB27: TTC1688Help
Entry
TTC1688           CDS       T00170                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
tth  Thermus thermophilus HB27
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:tth00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TTC1688
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TTC1688
   00052 Galactose metabolism
    TTC1688
   00500 Starch and sucrose metabolism
    TTC1688
   00520 Amino sugar and nucleotide sugar metabolism
    TTC1688
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    TTC1688
   00524 Butirosin and neomycin biosynthesis
    TTC1688
Enzymes [BR:tth01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     TTC1688
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(1604234..1605142)
Genome map
AA seq 302 aa AA seqDB search
MKVVGLDLGGTKIAAGVFDGKRLLSKVVVPTPKEGGERVAEALAEAAERAEREAGVRGEA
IGLGTPGPLDFRRGVIRFAPNIPGVQDFPIRRILEEATGRPVFLENDANAAALAEHHLGA
AQGEESSLYLTVSTGIGGGVVLGGRVLRGERGQGGELGHLTLLPGGPACGCGLEGCLEAL
AAGRALERDATYAFQRPVDTRELFRLFQAGDPKAERLVLQAARYVGIGLASLVKAFDPGV
VVLGGGVALNAPEGYWEALLEAYRRYLQGWEAPPLRRARLGAEAGLLGAALTAYLEVKDG
SG
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
gtgaaggtggtgggcctggacctgggcggcaccaagatcgccgccggcgtctttgacgga
aagaggctcctctccaaggtggtcgtccccacgcccaaggagggcggggagcgggtggcc
gaggccctggccgaggccgcggagcgggcggagagggaggcgggggtccggggggaggcc
atcggcctggggacgcccggccccctggacttccgccgcggggtgatccgcttcgccccc
aacatcccgggggtccaggacttccccatccgccggatcctggaggaggccacggggagg
cccgtcttcctggaaaacgacgccaacgccgccgctttggccgagcaccacctgggggcg
gcccagggagaggagagctccctctacctcaccgtctccacggggatcgggggcggggtg
gtcctggggggaagggtgctccggggggagcgagggcagggcggggagctcggccacctg
accctcctccccggggggcccgcctgcggctgcggactggagggctgcctcgaggccctg
gccgcgggccgcgccctggagcgggacgccacctacgccttccagcgccccgtggacacg
cgggagctcttccgcctcttccaggcaggggaccccaaggcggagcgcctcgtcctccag
gccgcccggtacgtgggcatcggcctcgccagcctggtgaaggcctttgaccccggggtg
gtggtcctggggggcggggtggccctgaacgcccccgaggggtactgggaggccctcctc
gaggcctaccgccgctacctccaaggctgggaggccccccccttgcggagggcccgcctg
ggagccgaggccgggcttctgggcgcggccctcaccgcctacctggaggtgaaggatgga
agcgggtaa

DBGET integrated database retrieval system