KEGG   Thermus thermophilus HB27: TTC1696Help
Entry
TTC1696           CDS       T00170                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
tth  Thermus thermophilus HB27
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:tth00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    TTC1696 (ruvA)
Enzymes [BR:tth01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     TTC1696 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(1609248..1609823)
Genome map
AA seq 191 aa AA seqDB search
MIRYLRGLVLKKEAGGFVLLAGGVGFFLQAPTPFLQALEEGKEVGVHTHLLLKEEGLSLY
GFPDEENLALFELLLSVSGVGPKVALALLSALPPRLLARALLEGDARLLTSASGVGRRLA
ERIALELKGKVPPHLLAGEKVESEAAEEAVMALAALGFKEAQARAVVLDLLAQNPKARAQ
DLIKEALKRLR
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgatccgctacctccggggcctggtcctcaagaaggaggcgggcggcttcgtccttctc
gccgggggggtggggttcttcctccaggcccccacgcccttcctccaggccctggaggag
gggaaggaggtgggggtccacacccacctcctcctcaaggaggaggggctgtccctctac
ggcttccccgacgaggagaacctcgccctctttgaactcctcctctcggtgagcggcgtg
gggcccaaggtggccctcgccctcctctcggccctgccccctaggctcctcgcccgggcc
ctcctggagggggacgcgaggctcctcacctcggcgagcggggtggggagaaggctcgcc
gaaaggatcgccctggagctcaaggggaaggtgcccccccacctcctcgccggggagaag
gtggagagcgaggccgcggaggaggcggtgatggccctcgccgccttggggttcaaggag
gcccaggcgcgggcggtggtcctggacctcctggcccaaaaccccaaggcccgggcccag
gacctcatcaaggaggccctaaagcgcctccgctag

DBGET integrated database retrieval system