KEGG   Thermus thermophilus HB27: TTC1699Help
Entry
TTC1699           CDS       T00170                                 

Definition
dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
tth  Thermus thermophilus HB27
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:tth00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TTC1699
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    TTC1699
  Amino acid metabolism
   00310 Lysine degradation
    TTC1699
Enzymes [BR:tth01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     TTC1699
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1613363..1614583
Genome map
AA seq 406 aa AA seqDB search
MQELKVPSVGESIVEVEIGAWLKGEGESFAQDEPLVELITDKATLELPAPFAGTLKQILK
KTGETARVGEAIALLEEGRAEAAPKAQAPAEAPKEPSPEPLAMPAAERLMQEKGVSPAEV
QGTGLGGRILKEDVMRHLEERTPTKPQEAPPPPPPSRPVPPPSTPTQPPADKPWRVSEAV
PMTPLRRRIAERLLMVRQTTAMLTTFNEADMSAVIALRKEFGEAFQKKYGVKLGFMSFFV
KAVVQALKEIPELNAEIRDNHIVYHRYYDIGIAVGGGEGLVVPVIRDADRLSFAEIEQKI
ADFAERARTKKLKPEELMGGTFTITNGGIYGSLNSTPLLNPPQVGILGMHAIQERPVVRD
GQVVIRPMMYLALSYDHRIVDGREAVTFLRRVKELIENPARLLLEV
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
gtgcaggaactcaaggtgccctccgtgggcgaaagcatcgtggaagtggagatcggcgct
tggcttaagggagaaggggagagcttcgcccaggacgagcccttggtggagctcatcacc
gacaaggccaccttggagctccccgcccccttcgccgggaccctgaagcagatcctgaag
aagaccggggagaccgcccgggtgggggaggccatcgccctcctggaggaggggagggcg
gaggccgcgcccaaggcccaggcgcccgccgaggcccccaaggagccctccccggagcct
ttggccatgcccgccgcggagcgcctcatgcaggaaaagggcgtctccccggcagaggtt
caggggacgggactgggcgggcggatccttaaggaggacgtgatgcgccacctggaggaa
aggacccccaccaagccccaggaggccccgccgcctcctcccccctcccgccccgtgccc
ccgccctccacccccacgcagccccccgccgacaagccctggcgggtgagcgaggccgtg
cccatgacgcccttgcgccgccggatcgccgagcgcctcctcatggtccgccagaccacg
gccatgctcaccaccttcaacgaggcagacatgtcggcggtgatcgccctcaggaaggag
ttcggcgaggccttccagaagaagtacggggtcaagcttggcttcatgagcttcttcgtc
aaggccgtggtccaggccctcaaggagatccccgagctcaacgccgagatccgggacaac
cacatcgtctaccaccgctactacgacatcggcatcgccgtgggcgggggcgagggcctg
gtggtccccgtgatccgcgacgccgaccgcctctccttcgccgagattgagcaaaagatc
gccgattttgccgaaagggcccgcaccaagaagctcaagcccgaggagctcatggggggc
accttcaccatcaccaacggggggatctacggctccctgaactccacccccctcctcaac
ccgccccaggtggggatcctgggcatgcacgccatccaggagcgccccgtggtccgggac
ggccaggtggtcataaggcccatgatgtacctcgccctctcctacgaccaccgcatcgtg
gacggacgggaggcggtcaccttcctccgccgggtgaaggagctcattgagaacccggcg
cggctccttttggaggtgtag

DBGET integrated database retrieval system