KEGG   Thermus thermophilus HB27: TTC1768Help
Entry
TTC1768           CDS       T00170                                 

Definition
enoyl-CoA hydratase (EC:4.2.1.17)
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
tth  Thermus thermophilus HB27
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:tth00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    TTC1768
  Carbohydrate metabolism
   00640 Propanoate metabolism
    TTC1768
   00650 Butanoate metabolism
    TTC1768
  Lipid metabolism
   00071 Fatty acid degradation
    TTC1768
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    TTC1768
   00310 Lysine degradation
    TTC1768
   00360 Phenylalanine metabolism
    TTC1768
   00380 Tryptophan metabolism
    TTC1768
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    TTC1768
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    TTC1768
   00281 Geraniol degradation
    TTC1768
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    TTC1768
   00627 Aminobenzoate degradation
    TTC1768
   00930 Caprolactam degradation
    TTC1768
Enzymes [BR:tth01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     TTC1768
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1675541..1676335)
Genome map
AA seq 264 aa AA seqDB search
MLASLEARYPGLAFAWPRPGVLEITFRGEKLNAMPPALHRALARVWRDLEAVEGVRAVLL
RGEGGVFSAGGSFGLIEEMRASHEALLRVFWEARDLVLGPLNFPRPVVAAVEKVAVGAGL
ALALAADIAVVGKGTRLLDGHLRLGVAAGDHAVLLWPLLVGMAKAKYHLLLNEPLTGEEA
ERLGLVALVVEDEKVYEKALEVAERLAQGPKEALHHTKHALNHWYRSFLPHFELSLALEF
LGFSGKELEEGLKALKEKRPPEFP
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgctggcctctttggaagcccgctacccggggctcgccttcgcctggccgaggcccggc
gtcctggagatcaccttccgcggggagaagctcaacgccatgccccctgccctccaccgg
gccctggcccgggtgtggcgggacctcgaggcggtggagggggtaagggccgtgctcctt
cggggcgagggcggggtcttctccgccgggggctccttcggcctcattgaggagatgcgg
gcctcccacgaggccctcctccgggtcttctgggaggccagggacctcgtgctcgggccc
ctcaacttcccgaggcccgtggtggcggcggtggagaaggtggcggtgggggcggggctt
gccctggccctcgccgccgacatcgccgtggtggggaaggggacgaggcttcttgacggc
cacctccgcctcggggtggcggcgggggaccacgccgtcctcctctggcccctcctcgtg
ggcatggccaaggccaagtaccacctcctcctgaacgagcccctcacgggggaggaggcg
gagcgcctgggcctcgtggccttggtggtggaggacgaaaaggtctacgagaaggccctc
gaggtggcggaaaggctcgcccaaggccccaaggaggccctccaccacaccaagcacgcc
ttaaaccactggtaccggagcttcctcccccactttgagctctccttggccctggagttt
ttggggttttccgggaaggagctggaggagggcctcaaggccctcaaggagaagcgcccc
cccgagttcccatga

DBGET integrated database retrieval system