KEGG   Thermus thermophilus HB27: TT_P0024Help
Entry
TT_P0024          CDS       T00170                                 

Definition
alkaline phosphatase (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
tth  Thermus thermophilus HB27
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:tth00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:tth00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:tth02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pTT27:complement(19903..21408)
Genome map
AA seq 501 aa AA seqDB search
MKRRDILKGGLAAGALALLPRGHTQGALQNQPSLGRRYRNLIVFVYDGFSWEDYAIAQAY
ARRRQGRVLALERLLARYPNGLINTYSLTSYVTESSAAGNAFSCGVKTVNGGLAIHADGT
PLKPFFAAAKEAGKAVGLVTTTTVTHATPASFVISNPDRNAEERIAEQYLEFGAEVYLGG
GDRFFNPARRKDGKDLYAAFAAKGYGVVRTPEELARSNATRLLGVFADGHVPYEIDRRFQ
GLGVPSLKEMVQAALPRLAAHRGGFVLQVEAGRIDHANHLNDAGATLWDVLAADEVLELL
TAFVDRNPDTLLIVVSDHATGVGGLYGAGRSYLESSRGVDLLEPQRASFEHMLRVLGQAP
EASQVKEAFRAMKGVDLEDAEAERVVRAIREKVYWPEGVRQGVQPANTLAWAMAQRNAQK
PDRPNIGYSSGQHTASPVMLLLYGQGLRFVNLGLVDNTHVFRLMGEALGLRYQNPVMSEE
EALEILKARPQGMRHPEDVWA
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgaagggacatcctgaaaggtggcctggctgcgggggccctggccctcctgccc
cggggccatacccagggggctctgcagaaccagccttccttgggaaggcggtaccgcaac
ctcatcgtcttcgtctacgacgggttttcctgggaggactacgccatcgcccaggcctac
gcccggaggcggcagggccgggtcctggccctggagcgcctcctcgcccgctaccccaac
gggctcatcaacacctacagcctcaccagctacgtcaccgagtccagcgccgcggggaac
gccttctcctgcggggtgaagacggtgaacggggggctcgccatccacgccgacgggacc
cccctcaagcccttcttcgccgcggccaaggaagcggggaaggccgtggggctcgtgacc
accaccaccgtcacccacgccaccccggcgagcttcgtgatctccaatcccgaccggaac
gccgaggagaggatcgccgagcagtacctggagttcggggccgaggtgtacctggggggc
ggggaccgctttttcaaccccgccaggcgcaaggacgggaaggacctctacgccgccttc
gccgccaaggggtacggggtggtgcgcacccccgaggagctcgcccgttccaacgccacc
cggctcctgggcgtcttcgccgacggccacgtgccctacgagattgaccgccgcttccag
ggccttggggtgccgagcctcaaggaaatggtccaggccgctttgccccggcttgccgcc
caccgcgggggcttcgtccttcaggtggaagcggggcggattgaccacgccaaccatttg
aacgacgccggggccaccctttgggacgtgctggcggcggacgaggtcctggagctcctc
accgccttcgtggaccggaacccggacaccctcctcatcgtggtctcggaccacgccacc
ggggtaggggggctttacggggccgggcggagctacctggagagctcccgaggggtggac
ctcctggagccgcagcgggcgagctttgagcacatgctccgcgtcctcggccaggccccg
gaggcctcccaggtcaaggaagccttccgggccatgaagggggtggacctcgaggacgcc
gaggcggaaagggtggtgcgggccatccgggagaaggtctactggccggagggggtgcgc
cagggggtccagcccgccaacaccctggcctgggccatggcgcagcggaacgcccagaag
cccgaccgacccaacatcggctatagctccggccagcacacggcaagccccgtgatgctc
ctcctctacggccagggcctgcgctttgtgaacctgggcctcgtggacaacacccacgtc
ttccgcctcatgggggaggcccttggcctccgctaccagaacccggtgatgagcgaggag
gaggccctggagatcctcaaggccaggccccaggggatgcgccaccccgaggacgtctgg
gcctaa

DBGET integrated database retrieval system