KEGG   Thermus thermophilus HB27: TT_P0024Help
Entry
TT_P0024          CDS       T00170                                 

Definition
alkaline phosphatase (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
tth  Thermus thermophilus HB27
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:tth00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    TT_P0024
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    TT_P0024
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    TT_P0024
Enzymes [BR:tth01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     TT_P0024
Exosome [BR:tth04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   TT_P0024
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pTT27:complement(19903..21408)
Genome map
AA seq 501 aa AA seqDB search
MKRRDILKGGLAAGALALLPRGHTQGALQNQPSLGRRYRNLIVFVYDGFSWEDYAIAQAY
ARRRQGRVLALERLLARYPNGLINTYSLTSYVTESSAAGNAFSCGVKTVNGGLAIHADGT
PLKPFFAAAKEAGKAVGLVTTTTVTHATPASFVISNPDRNAEERIAEQYLEFGAEVYLGG
GDRFFNPARRKDGKDLYAAFAAKGYGVVRTPEELARSNATRLLGVFADGHVPYEIDRRFQ
GLGVPSLKEMVQAALPRLAAHRGGFVLQVEAGRIDHANHLNDAGATLWDVLAADEVLELL
TAFVDRNPDTLLIVVSDHATGVGGLYGAGRSYLESSRGVDLLEPQRASFEHMLRVLGQAP
EASQVKEAFRAMKGVDLEDAEAERVVRAIREKVYWPEGVRQGVQPANTLAWAMAQRNAQK
PDRPNIGYSSGQHTASPVMLLLYGQGLRFVNLGLVDNTHVFRLMGEALGLRYQNPVMSEE
EALEILKARPQGMRHPEDVWA
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgaagggacatcctgaaaggtggcctggctgcgggggccctggccctcctgccc
cggggccatacccagggggctctgcagaaccagccttccttgggaaggcggtaccgcaac
ctcatcgtcttcgtctacgacgggttttcctgggaggactacgccatcgcccaggcctac
gcccggaggcggcagggccgggtcctggccctggagcgcctcctcgcccgctaccccaac
gggctcatcaacacctacagcctcaccagctacgtcaccgagtccagcgccgcggggaac
gccttctcctgcggggtgaagacggtgaacggggggctcgccatccacgccgacgggacc
cccctcaagcccttcttcgccgcggccaaggaagcggggaaggccgtggggctcgtgacc
accaccaccgtcacccacgccaccccggcgagcttcgtgatctccaatcccgaccggaac
gccgaggagaggatcgccgagcagtacctggagttcggggccgaggtgtacctggggggc
ggggaccgctttttcaaccccgccaggcgcaaggacgggaaggacctctacgccgccttc
gccgccaaggggtacggggtggtgcgcacccccgaggagctcgcccgttccaacgccacc
cggctcctgggcgtcttcgccgacggccacgtgccctacgagattgaccgccgcttccag
ggccttggggtgccgagcctcaaggaaatggtccaggccgctttgccccggcttgccgcc
caccgcgggggcttcgtccttcaggtggaagcggggcggattgaccacgccaaccatttg
aacgacgccggggccaccctttgggacgtgctggcggcggacgaggtcctggagctcctc
accgccttcgtggaccggaacccggacaccctcctcatcgtggtctcggaccacgccacc
ggggtaggggggctttacggggccgggcggagctacctggagagctcccgaggggtggac
ctcctggagccgcagcgggcgagctttgagcacatgctccgcgtcctcggccaggccccg
gaggcctcccaggtcaaggaagccttccgggccatgaagggggtggacctcgaggacgcc
gaggcggaaagggtggtgcgggccatccgggagaaggtctactggccggagggggtgcgc
cagggggtccagcccgccaacaccctggcctgggccatggcgcagcggaacgcccagaag
cccgaccgacccaacatcggctatagctccggccagcacacggcaagccccgtgatgctc
ctcctctacggccagggcctgcgctttgtgaacctgggcctcgtggacaacacccacgtc
ttccgcctcatgggggaggcccttggcctccgctaccagaacccggtgatgagcgaggag
gaggccctggagatcctcaaggccaggccccaggggatgcgccaccccgaggacgtctgg
gcctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system