KEGG   Thermus thermophilus HB27: TT_P0072Help
Entry
TT_P0072          CDS       T00170                                 

Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
tth  Thermus thermophilus HB27
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:tth00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    TT_P0072
  Lipid metabolism
   00561 Glycerolipid metabolism
    TT_P0072
   00600 Sphingolipid metabolism
    TT_P0072
Enzymes [BR:tth01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     TT_P0072
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pTT27:complement(65221..66651)
Genome map
AA seq 476 aa AA seqDB search
MRLNLGGAEVFLRAEGLEEAPGGVRLWGREVRVFPPFPAKGFFRHGWQSWSLAAWVDPAQ
APTPLLPEARRPQADDPFLLEAGAWWGSGVGALRGPDGRALLLGALDLGARVLGREDLLL
GRYAGEGGAWFLAHGPEEEVFAAYAQLLPRRLSGRPPRVWCSWYSFYTRIGEDLLLRVLD
EVAAFSFEVFQIDDGWQRALGDWEPNDRFPRGMAFLAERIRERGLRPGLWFAPFLVTADS
PLFQMRPDWVLRDGEGRPVRAGFNWGRPLYALDAGNEEVVEWAADLVRKALAWGYDYLKL
DFLYAAALPGAEGEARYRRAMARLREAAGEAYLLFCGAPVLASLGLADGLRVGPDVAPYW
DNEERSFWLADPTGPGLRNALRSTLHRLWLMENVHVDPDVVYFRTRFNLLSPEEMRLQEA
LAHFTGFKATSDPPSWLLPEEKGRLEAFLAREVPVRRLGPYRFRVGEEEVDYAPLL
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgaggctgaacctaggaggagcggaggttttcctcagggcggagggcctggaggaggcc
ccggggggagtgcgcctttggggcagggaggtgcgggtctttccccctttccccgccaag
gggttcttccgccacggctggcagagctggagcctcgccgcctgggtggaccccgctcag
gcccccacgcccctcctccccgaggcgcgccgcccccaggcggatgaccccttcctcctg
gaggccggggcgtggtggggaagcggcgtgggggcccttagggggccggacgggagggcg
ctccttctcggcgccctagaccttggggccagggtcctgggccgggaggacctcctcctc
ggccgctacgccggagagggcggggcctggttcctcgcccacggcccggaggaggaggtc
ttcgccgcctacgcccagcttctccccaggcgcctttccgggaggccccccagggtgtgg
tgctcctggtacagcttctacacgaggattggcgaggacctccttcttcgggttctggac
gaggtggcggccttctcctttgaggtcttccagatagacgacggctggcagcgggccctc
ggggactgggagcccaacgaccgcttcccccgggggatggccttcctcgcggagaggatc
cgggaaaggggcctgaggccggggctttggttcgcccccttcctggtcacggcggatagc
cccctcttccaaatgcggcccgactgggtgctgagggacggggaggggaggcccgtgcgg
gcgggcttcaactggggcaggcccctctacgccctggacgcggggaacgaggaggtggtg
gagtgggccgcggacctcgtgcgtaaggccctcgcctggggctacgactacctgaagctg
gacttcctctacgccgccgcccttcccggggccgagggggaggcccgctaccggagggcc
atggcccgcctgcgggaggcggcgggggaggcctacctcctcttctgcggggcccccgtc
ctcgcctccctgggcctcgccgacggcctccgggtaggccccgacgtggccccctactgg
gacaacgaggagcgctccttttggcttgcggaccccacggggccgggcctaaggaacgcc
ctccgctccaccctccaccgcctctggctcatggagaacgtccatgtggaccccgatgtg
gtctatttccgcacccgctttaacctgctttcccccgaggagatgcggcttcaggaggcc
ttggcccacttcaccggcttcaaggccacttccgacccgccctcgtggctcctcccggag
gaaaaggggcgcctcgaggccttcctcgcccgggaggtcccggtgcggcgcctcggcccc
taccgctttagggtaggggaggaggaggtggactatgccccccttctataa

DBGET integrated database retrieval system