KEGG   Thermus thermophilus HB27: TT_P0220Help
Entry
TT_P0220          CDS       T00170                                 

Definition
beta-galactosidase protein (EC:3.2.1.23)
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
tth  Thermus thermophilus HB27
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tth00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    TT_P0220
  Lipid metabolism
   00600 Sphingolipid metabolism
    TT_P0220
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    TT_P0220
Enzymes [BR:tth01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     TT_P0220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pTT27:217503..219227
Genome map
AA seq 574 aa AA seqDB search
MRLDPNHPRPTLQRPGWRSLEGHWDFALSEAEAPGGVRFDRKILVPFPPEAPGSGVGEAW
VGVAWYRKVLRAKPRPGRRLFLRFGAVDYRAEVFVNGVRVLEHEGGHTPFGLDLTPFLER
PVEVLVRAEDDPLDPEAPRGKQALGEPGGIFYPRTTGIWQPVWLEWVPESHIAALRLTPD
LKALGFHLEVQAHGEGEAVEVALFPGVRGEAPLGEAPWLEARFPLLGERASGFLGLPAKG
SPEGLLWRPETPVLFPLRLRLLSGRRVLDEVYSYGGLREVAAQKGVFLLNGEPYFPRLVL
DQGLWPEGHLAPPSLAALRRDAALAKALGFNGVRKHQKVEDPRYLHLADRLGLLVFAEMP
SFFRFSPKAARRYLAELAEALERDRNHPSLVAWILFNEGWGLTPWRAETLAFLQGAFLLA
RALDPTRLLVDNDGFEHGPFWDLLTVHDYAPPEVLARRYGEGLPEAPMGRPLALAGLPPG
VRPFLSEFGGLRLKGPGPGWGYREAEGEEAFLREALRYLETACGSRLSGFCYTQLYDTFQ
EENGLLDFWRRPKVPPERVRAFLEGCEARRLLAE
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atgcggctggaccccaaccaccccaggcccaccctccagcgccccggctggcggagcctc
gagggccactgggacttcgccctaagcgaggccgaggcgcccggcggggtgcggtttgac
cggaagatcctcgtccccttcccccccgaggccccgggaagcggggtcggggaggcctgg
gtgggggtggcctggtaccggaaggtcctgcgggccaagccccggccaggacggcggctt
ttcctccgcttcggggccgtggactaccgggcggaggtcttcgtgaacggggtgcgggtc
ctggagcacgagggggggcacacccccttcggcctggacctcacccccttcctggaaagg
cccgtggaggtcctggtgcgggccgaggacgaccccctggacccggaagccccccggggc
aagcaggccctgggggagcccgggggcatcttctacccccgcaccaccgggatctggcag
ccggtctggctggagtgggtgccggaaagccacatcgccgccctgcgcctgaccccggac
ctcaaggccctgggcttccacctcgaggttcaggcccatggcgagggggaggcggtggag
gtggccctcttccccggggtgagaggggaggccccccttggggaggcgccctggctggag
gcccgcttccccctcctcggggagagggcctccgggttcctcggcctccccgcgaagggg
agcccggaaggcctcctctggcggccggaaacccccgtcctcttccccttgcgcctccgc
ctcctctccgggaggcgggtcctggacgaggtctacagctacggggggctcagggaggtg
gccgcccaaaaaggggtcttcctcctcaacggggagccctacttccccaggctggtcctg
gaccaggggctctggcccgaaggccacctcgcgcccccaagcctcgccgccctccggcgg
gacgcggcgctcgccaaggccctgggcttcaacggggtgcgcaagcaccagaaggtggag
gacccccgctacctccacctggcggaccggctcggcctcctcgtcttcgcggagatgccg
agcttcttccgcttctcccccaaggcggcccggcgctacctcgccgagctcgccgaggcc
ctggagcgggaccggaaccaccccagcctggtggcctggatcctcttcaacgagggctgg
ggcctcaccccctggcgggccgagaccctggccttcctccagggggccttcctcctggcc
cgcgccctggaccccacccgcctcctcgtggacaacgacggctttgagcacgggcccttt
tgggacctcctcaccgtgcacgactacgcccctccggaggtcctggcccgtaggtacggg
gaaggcctccccgaggcccccatgggccgccccctcgccctggcgggccttcctccaggg
gtgcgccccttcctctcggagttcggagggctcaggctcaaggggccgggcccgggctgg
gggtaccgggaggcggagggcgaggaggccttcctgcgggaggcgctccgctacctggaa
accgcgtgcggaagccgcctgagcgggttctgctacacccagctctacgacaccttccag
gaggagaacggcctcctggacttctggcggaggcccaaggtgccccccgagagggtccgg
gccttcctggagggttgcgaggcgaggcggcttctcgcggagtag

DBGET integrated database retrieval system