KEGG   Thermus thermophilus HB27: TT_P0222Help
Entry
TT_P0222          CDS       T00170                                 

Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
tth  Thermus thermophilus HB27
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:tth00052]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:tth00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:tth00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pTT27:221617..223665
Genome map
AA seq 682 aa AA seqDB search
MRVEKAWFLADGAEAPEGLPEGGFREVALPHQWSLEGVEAEVGWYRLALPEAGPRRFLLS
FGDYYQEAWLDGTYLGRHEGYFFPWVLELPKGKELFLRVSAPKEPLGVWPRFKRQIKGVF
GQHDCRPGGTTARGQERGTGGLWGGVEVWAREEVALLGLTHRLFPRPGGWRLWARLLVDA
TRPFRERARLALSPVNFPGEVLEREALLEGEAGRGWREVVWDLPEMPLWEVWERGFPHLF
RLEADLLGARLGVPLGFRTVAVDGEGWLLLNGKRLFLRGTNAIPTQWLAGYSEEMAQRDV
ALIKEAGLNAVRVHAHVTHPAFYEGCDREGVLVWQDFPLQWGYAPDEAFAQEALRQARAM
VEVLGAHPSAYLWCAQNEPTHNRHALGPLLGAALRAADPTRPVKEASDFREHPYPGWYWG
HYRDFLALPGAPLPSEFGAQALPRAELLRRVLGEAAWPPRWEVWGYHNFQPHETFRVAGV
EMGESLEEFVERSQDYQARLLEFAVHAYRRAKGKVVGYFQFMFVEPWEGITWAVLDVERV
PKKGFFALKEASSPVLLSLVPYLERVEVGAPPLQEAWLVSDLDRPLSLRVRLRLEGPATL
LLHEEEIALDAGEVRRFFSLGELWESPLEVQARFLPLREALARIPPGAYRLVGEAWEGER
LWSRHVLSVEYLEPILPLEVAW
NT seq 2049 nt NT seq  +upstreamnt  +downstreamnt
atgagggtggagaaggcgtggtttctggcggatggggcagaggccccggaggggcttccc
gaggggggcttccgggaggtggccctgccccaccagtggagcctggagggggtagaggcg
gaggtgggctggtaccgcctcgccctgcccgaggcagggcccaggcgcttcctcctttcc
tttggggactactaccaggaggcctggctggacgggacctacctgggccggcacgagggc
tacttcttcccctgggtcctggagcttcccaaggggaaggagctcttcctaagggtctcc
gcccccaaggagccccttggggtctggccccggttcaagcggcagatcaagggggtcttc
ggccagcacgactgccgccccggggggaccacggcgaggggccaggagcgggggaccggg
gggctatggggcggggtggaggtctgggcccgggaggaggtggccctcctcggcctcacc
caccgcctcttcccccggcccggggggtggcggctttgggcgcgcctcctggtggacgcc
acaaggcccttccgcgagcgggcgcgcctcgccctgagcccggtcaacttccccggggag
gtcctggagcgggaggcccttctggagggggaggcggggcggggttggcgggaggtggtc
tgggacctgccggagatgcccctttgggaggtgtgggagcggggctttccccacctcttc
cgcctcgaggcggacctcctcggggcgcggcttggcgtccccttgggcttccgcaccgtg
gcggtggacggggagggctggcttcttctcaacgggaagcggcttttcctgcggggcacc
aacgccatccccacccagtggctcgcgggctactcggaggagatggcgcaaagggacgtg
gccctcatcaaggaagcgggcctcaacgccgtgcgggtccacgcccacgtgacccacccc
gccttctacgaaggctgcgaccgggaaggggtcctggtctggcaggacttccccctgcag
tggggctacgccccggacgaggccttcgcccaggaggccctgcgccaggcccgagccatg
gtggaggtcctgggggcccaccccagcgcctacctctggtgcgcccagaacgagcccacc
cacaaccgccacgccctgggccccctcctgggagcggcgctaagggcggcggaccccacc
cggcccgtgaaggaggcctcggacttccgcgagcacccctaccccggctggtactggggg
cattaccgggacttcctcgccctccccggggcccccctcccctcggagttcggggcccag
gccctgccccgggcggagctcctaaggcgggtcctgggggaggccgcctggccccccagg
tgggaggtctggggctaccacaacttccagccccacgagaccttccgggtggccggggtg
gagatgggggaaagccttgaggagttcgtggagcgctcccaggactaccaggcgaggcta
ttggagttcgccgtccacgcctaccggagggccaaggggaaggtggtgggctacttccag
ttcatgttcgtggagccttgggaggggatcacctgggcggttttggacgtggagcgggtt
cccaagaagggcttcttcgcccttaaggaggccagcagccccgtcctcctctccctggtg
ccctacctggagagggtggaggtgggcgccccccccttgcaggaggcctggctcgtaagc
gacctggaccggcccttaagcctccgggtccgcctccgcctcgagggccccgccaccctc
ctcctccacgaggaggagatcgccctggacgcgggggaggtgcggcggtttttcagcctg
ggggagctttgggaaagccccttggaggtccaggcccgcttcctgcccctgcgggaagcc
ctggcccgcatcccccccggggcctaccgcctggtgggggaggcctgggagggggagagg
ctctggtcccgccacgtcctcagcgtggagtacctggagcccatcctgcccctggaggtg
gcctggtga

DBGET integrated database retrieval system