KEGG   Thermus thermophilus HB8: TTHA0100Help
Entry
TTHA0100          CDS       T00220                                 

Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
ttj  Thermus thermophilus HB8
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:ttj00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    TTHA0100
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    TTHA0100
Enzymes [BR:ttj01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     TTHA0100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
100538..101986
Genome map
AA seq 482 aa AA seqDB search
MPTLKELFALFGKEAPEVPVRGLTLDSRRVEPGFVFVAVPGVPLPHRKPLDGHDFVPEAL
ARGAVAVVGERPLALPVPYLQVADGRQALALLARRFHGEPDRKLLLVGVTGSKGKSTTAS
LLHHLLKRAQGGSALLSTVGLRLGEEARPPVGHFTTPEAPEVYAFLREAADRGLKSAVLE
VSSHALALKRVEGLTFRVGVFVNFYPDDHLDFHGTAEAYFRAKALLVERSDLAVLARSLP
HFPRLAQRPHLSFGEGGEVYAEGLRETPEGLAFRLHTPWGSGEAFLPLLGAYNLENALAA
SAAALALGVGLEAVLEGLATFPGVPGRMEVVLKAPFRVVIDFAHTGKSLEAALKTLRPTT
PGRLLLVVGAAGERDPQRRVDIGRVAARLADKTFFTEEDHRGEDLFAILEAMAQAARAEG
GVYELVPDREEAILKAILEARPGDTVLLAGKGHEATLERGQVALPWNEREAALKALRARG
LP
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgcccaccttgaaggagctcttcgccctcttcgggaaggaagccccggaggtgcccgtc
aggggcctcaccctggactcgaggcgggtggagcccggcttcgtcttcgtggccgtaccc
ggggttcccctcccccaccggaagcccctggacgggcacgacttcgtccccgaggccctg
gcccggggggcggtggccgtggtgggggaaaggcccctcgccctccccgtcccctacctc
caggtggccgacggccgccaggccctcgccctcctggcccggcgcttccacggggagccg
gaccggaagctcctcctcgtgggggtcacggggtccaagggcaagagcaccacggcaagc
ctcctccaccacctcctaaagcgggcccagggcggaagcgccctcctctccaccgtgggc
ctccgcctgggcgaggaggcccgcccccccgtgggccacttcaccaccccggaagccccc
gaggtctacgccttcctccgggaggcggcggaccgcggcctgaaaagcgccgtgctggag
gtctccagccacgccctggccctgaagcgggtggagggcctcaccttccgggtgggggtc
ttcgtgaacttctaccccgacgaccacctggacttccacggcaccgccgaggcctacttc
cgggccaaggccctcctggtggagcggtcggacctcgccgtcctcgcccgtagcctcccc
cacttcccccggctcgcccagaggccccacctgagcttcggggagggaggggaggtctat
gcggaggggcttcgggaaaccccggagggcctggccttccgcctccacaccccctggggg
tcaggggaggccttcttgcccctcctcggggcctacaacctggaaaacgccctcgccgca
agcgccgccgccctggccctgggggtgggcctcgaggcggtgctggagggcctcgccacc
ttccccggggtgccgggccggatggaggtggtcctcaaggcccccttccgcgtggtcatt
gacttcgcccacaccgggaagagcctggaggccgccctgaagaccctccgccccaccacc
ccggggaggctccttttggtggtgggggcggccggggagcgggacccccagcggcgcgtg
gacatcggccgggtggcggcccgcctcgcggacaagaccttcttcaccgaggaggaccac
cggggcgaggacctcttcgccatcctggaggccatggcccaggcggcccgggccgagggc
ggggtctacgagctcgtccccgaccgggaggaggccatcctcaaggccatcctcgaggcc
cgccccggggacacggtcctgctcgccggcaaggggcacgaggccaccttggagcggggc
caggtggccctgccctggaacgagcgggaggccgccctcaaagccctccgggcgcggggg
cttccctga

DBGET integrated database retrieval system