KEGG   Thermus thermophilus HB8: TTHA0140Help
Entry
TTHA0140          CDS       T00220                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
ttj  Thermus thermophilus HB8
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ttj00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    TTHA0140
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    TTHA0140
Enzymes [BR:ttj01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     TTHA0140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
136879..138156
Genome map
AA seq 425 aa AA seqDB search
MGVSRVLHVEGGTPLKGELRVYPAKNAALPILAASLLTPEPITLVEVPRLRDVEVMLELL
AHLGTQYAWEGRTLHLQTPEIKSTHAPYELVGQMRASFIVWGALLARAGEGHVSMPGGCA
FGFRPVDQHIKALEALGAEVWEEDGTFHARRTRPLSGRVVFDLPTVGGTEQAMLAVALGG
EATLVQAAVEPEVVDLGHFLALLGAEVEGLGSPIVRIKGAPRLKGGTYRIIPDRIEAGTY
LLAAAATRGSLTLEGVRPDHLDALLDKLWRSGHRLEVGEDWIRFRATPDPAPFHVEAREY
PGFPTDLQPIATAYLATVPGQSTVVDRIYPDRFTHVGELARMGAELYLRDRILTVQGRRL
HGAQVKALDIRAGGALVVAALSAEGASEIEGVYFLERGYEHLTERLQALGARVHLRESPV
ALAAD
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
gtgggcgtgagccgggtgctgcacgtggaaggcggcacccccttgaagggggagcttagg
gtctacccggccaagaacgccgccctgcccatcctcgccgcgagcctcctcacccccgag
cccatcaccctggtggaggtgccgaggcttagggacgtggaggtgatgctggagctcctc
gcccacctgggcacccagtacgcctgggagggccggaccctccacctccagaccccggag
atcaaaagcacccacgccccctacgagctcgtgggccagatgcgggcgagcttcatcgtc
tggggagccctcctcgctcgggccggggaggggcacgtctccatgccggggggatgcgcc
ttcggcttccgccccgtggaccaacacatcaaggccctcgaggccctgggggcggaggtc
tgggaggaggacggcaccttccacgcccgcaggacccgccccctctcggggcgggtggtc
tttgacctgcccaccgtggggggcacggagcaggccatgctggccgtggccctgggcggg
gaggccaccctggtccaggcggcggtggagcccgaggtggtggacctgggccacttcctc
gccctcctcggggccgaggtggaggggctgggaagccccatcgtccgcatcaagggggcg
ccccggctaaagggcggcacctaccgcatcatccccgaccgcatagaggccgggacctac
ctcctggcggcggccgccacccggggaagcctcaccctggaaggcgtgcgccccgaccac
ctggacgcccttttggacaagctttggcgctcggggcaccggctcgaggtgggggaagac
tggatccgcttccgggccaccccggaccccgcccccttccacgtggaggcccgggagtac
ccgggctttcccacggacctccagcccatcgccaccgcctacctggccaccgtccccggc
cagagcacggtggtggaccgcatctaccccgaccgcttcacccacgtgggggagctggcc
cgcatgggggcggagctctacctgcgggaccggatcctcaccgtccagggcaggcggctc
cacggcgcccaggtcaaggccctggacatccgggcgggaggggccttggtggtggcggcc
ctgagcgccgaaggcgcctcggagattgagggcgtctacttcctggagcggggctacgag
cacctcacggaaaggctccaggccctgggggcccgggtgcacctccgggaaagccccgtg
gccctggctgccgactga

DBGET integrated database retrieval system