KEGG   Thermus thermophilus HB8: TTHA0170Help
Entry
TTHA0170          CDS       T00220                                 

Definition
(RefSeq) 4-diphosphocytidyl-2C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
ttj  Thermus thermophilus HB8
Pathway
ttj00900  Terpenoid backbone biosynthesis
ttj01100  Metabolic pathways
ttj01110  Biosynthesis of secondary metabolites
ttj01130  Biosynthesis of antibiotics
Module
ttj_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:ttj00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    TTHA0170
Enzymes [BR:ttj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     TTHA0170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N
Motif
Other DBs
NCBI-GeneID: 3169608
NCBI-ProteinID: YP_143436
UniProt: P83700
Structure
PDB: 

Jmol
Position
complement(164439..165266)
Genome map
AA seq 275 aa AA seqDB search
MERLAPAKVNLGLSVRFRREDGYHELHTLFAPFSLADRLVVEPVSSGLHFQGPYGRENLA
YRAASLYLEAAGQPGGVRILLEKRIPEGAGLGGGSSDAAQVLLALQALYPAEVDLFALAR
TLGADVPFFLLGRGAEARGVGERLKPLALPPVPAVVFFPGLRVPTPLVYRAVRPEDFGPD
LPVEAILEALARGEEPPYWNSLEGPAFRLFPELKEVRGRMRALGLRGVLMSGSGSAFFGL
AEGPDHARRAAEALRAWGRAWAGTLGGGDAGSGPA
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atggagcgcctagcccctgcgaaggtcaacctcgggctttccgtccgcttccggcgggag
gacgggtaccacgagctccacaccctcttcgcccccttctccctggcggaccggctggtg
gtggagcccgtttcgtcgggcctccacttccaggggccctacgggcgcgagaacctggcc
taccgggcggcctccctctacctcgaggcggcgggccaacccgggggcgtgcgcatcctt
ttggagaagcggatccccgagggggccgggctcgggggcgggagttccgacgcggcccag
gtccttctcgccctccaggccctctacccggcggaggtggacctcttcgccctggcccgg
accctcggggcggacgtccccttcttcctcctcgggcggggggcggaggcccggggggtg
ggggagaggcttaagcccctcgccttgcccccggtccccgcggtggtcttttttcccggg
ctccgggtgcccacgcccttggtctaccgcgccgtgcggccggaggacttcggcccggac
ctccccgtggaggccatcctcgaggccttggcccggggggaggagcccccgtactggaac
agcctggaaggccccgccttccgcctcttccccgagctcaaggaggtgcggggccggatg
cgggctttggggcttaggggggtgctcatgtcgggctcggggagcgccttcttcgggctt
gcggaaggcccagaccacgcgaggcgggcggcggaggcgcttagggcctgggggcgcgcc
tgggccggcacgctgggaggtggggatgctgggtctggacctgcttaa

DBGET integrated database retrieval system