KEGG   Thermus thermophilus HB8: TTHA0184Help
Entry
TTHA0184          CDS       T00220                                 

Definition
(RefSeq) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ttj  Thermus thermophilus HB8
Pathway
ttj00010  Glycolysis / Gluconeogenesis
ttj00020  Citrate cycle (TCA cycle)
ttj00620  Pyruvate metabolism
ttj01100  Metabolic pathways
ttj01110  Biosynthesis of secondary metabolites
ttj01120  Microbial metabolism in diverse environments
ttj01130  Biosynthesis of antibiotics
ttj01200  Carbon metabolism
Module
ttj_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ttj00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TTHA0184
   00020 Citrate cycle (TCA cycle)
    TTHA0184
   00620 Pyruvate metabolism
    TTHA0184
Enzymes [BR:ttj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     TTHA0184
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_D23 NQRA GCV_H
Motif
Other DBs
NCBI-GeneID: 3169406
NCBI-ProteinID: YP_143450
UniProt: Q5SLV9
Position
complement(179036..180298)
Genome map
AA seq 420 aa AA seqDB search
MEVKLPELGDNVTQATVVGVLVKEGDRVEPGQPLLELETDKAVVEVPAEAGGVVKRVLVK
VGDEVRPGQPFLELAEAEGGAEAPPLKAEERPEAPAPKAEEAPRPAPKEAPPAPQEAPSE
RRLIPAAPSIRRLARELGVDLTRLRGTGLAGRITEEDVRRAAGLGEAAPAALPAAPAPRL
PDFTKWGPVRREPMSGVRKATVRSMSQAWAQVPMVTHFDEADVTELEALRKQYAKKAEEK
GFRLTLTAFLLKALALTLKAFPKFNASLDVEAQEIVYKDYIHIGVAVDTPHGLLVPVIRD
VDRKGVLRLAEELQEISQRARERKLSPEEMQGATFSLSNLGGIGGTGFTPIVNWPEVAIL
GVSRSQMKPLWDPGKEAFVPRLVMPFSLTYDHRLIDGADAARFCRHLAGILEDPLGLALA
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atggaggtcaagctacccgaactcggcgacaacgtaacgcaggcgaccgtggtgggcgtc
ctggtgaaggaaggggaccgggtggagccgggccagccccttctggagctggagacggac
aaggcggtggtggaggtgcccgcggaggcgggcggcgtggtgaagcgggttttggtcaag
gtgggggacgaggtgcgcccgggacagcccttcctggagctcgccgaggccgagggcggg
gcggaagcgcctccccttaaggcggaggaaaggccggaagcgcccgcccccaaggccgag
gaggcgccccgtcccgcccccaaggaagcccctcccgccccccaggaggcgccctccgag
cgccgcctcatcccggcggccccctccataaggcggctcgcccgggagctcggggtggac
ctcacccggctccggggcacggggcttgccgggcgcatcaccgaggaggacgtgcgccgg
gcggcgggccttggggaggcggccccggcggcccttccggcggcccccgcgcccaggctt
cccgacttcaccaagtggggccccgtgcgccgggagcccatgagcggggtgcgcaaggcc
acggtgcgctccatgagccaggcctgggcccaggtgcccatggtcacccactttgacgag
gcggacgtcaccgagctggaggctttgcgcaagcagtacgccaagaaggccgaggagaag
gggttccgcctcaccctcaccgccttcctcctcaaggccctggccctcaccctgaaggcc
ttccccaagttcaacgcctccctggacgtggaggcccaggagatcgtctacaaggactac
atccacatcggggtggcggtggacacgccccacggccttttggtcccggtgatccgcgac
gtggaccggaaaggggtcttgcgcctggcggaggagcttcaggagatctcccaaagggcc
cgggagcggaagctctcccccgaggagatgcagggggccaccttcagcctctccaacctg
ggggggatcggcggcaccggcttcacccccatcgtcaactggccggaggtggccatcctc
ggggtctcccgctcccagatgaaacccctttgggaccccgggaaggaggccttcgtgccc
cggctcgtgatgcccttcagcctcacctacgaccaccgcctgattgacggggcggacgcc
gcccgcttctgccgccaccttgcggggattctggaggaccccctgggcctcgccctagcc
tag

DBGET integrated database retrieval system