KEGG   Thermus thermophilus HB8: TTHA0191Help
Entry
TTHA0191          CDS       T00220                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
ttj  Thermus thermophilus HB8
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ttj00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    TTHA0191
Enzymes [BR:ttj01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     TTHA0191
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(186516..187400)
Genome map
AA seq 294 aa AA seqDB search
MGAPPLGPTIIPPVRTLWLRDRALDLDRVRLLGVLNLTPDSFSDGGRYLDPERALERARE
MVAEGADILDLGAESTRPGAAPVPVEEEKRRLLPVLEAVLSLGVPVSVDTRKPEVAEEAL
KLGAHLLNDVTGLRDERMVALAARHGVAAVVMHMPVPDPATMMAHARYRDVVAEVKAFLE
AQARRALSAGVPQVVLDPGFGFGKLLEHNLALLRRLDEIVALGHPVLVGLSRKRTIGELS
GVEDPAQRVHGSVAAHLFAVMKGVRLLRVHDVRAHREALGVWEALYGGDRPSRA
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgggcgcacctcctttaggacccactataatccctcctgtgcggacgctctggcttcgg
gaccgggccctggacctggaccgggtgcggctccttggggtgctgaacctcacccccgat
tccttctccgacgggggccggtacttggacccggagcgggcccttgagcgggcccgggag
atggtggccgagggggcggacattctggatttgggggccgagtccacccgccctggggcg
gcgcctgtgcccgtggaggaggagaagcggaggcttcttcccgtcctcgaggcggtcctt
tccctgggggtgccggtgagcgtggacacccgcaagcccgaggtggccgaggaggcccta
aagcttggggcccaccttctgaacgacgtcaccgggcttcgcgacgagcgcatggtggcc
ctggccgcccgccacggggtggccgccgtggtcatgcacatgccggtgccggacccggcc
accatgatggcccacgcccgctaccgggacgtggtggccgaggtcaaggccttcctcgag
gcccaggcgagaagggccctaagcgcaggggtgccccaggtggtcctggacccggggttc
ggcttcgggaagctcttggagcacaacctcgccctcctccgccgcctggacgagatcgtg
gccctgggccacccggtcttggtggggctttcccgcaagcgcaccatcggggagctttcc
ggggtggaggacccggcccagagggtccacggctccgtggccgcccacctcttcgccgtg
atgaagggggtgaggttgcttcgggtccacgacgtgcgggcccaccgggaggcccttggg
gtttgggaggcgctgtatgggggagatcgcccttctcgggcttga

DBGET integrated database retrieval system