KEGG   Thermus thermophilus HB8: TTHA0218Help
Entry
TTHA0218          CDS       T00220                                 

Definition
(RefSeq) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
ttj  Thermus thermophilus HB8
Pathway
ttj00071  Fatty acid degradation
ttj00280  Valine, leucine and isoleucine degradation
ttj00281  Geraniol degradation
ttj00310  Lysine degradation
ttj00360  Phenylalanine metabolism
ttj00362  Benzoate degradation
ttj00380  Tryptophan metabolism
ttj00410  beta-Alanine metabolism
ttj00627  Aminobenzoate degradation
ttj00640  Propanoate metabolism
ttj00650  Butanoate metabolism
ttj00903  Limonene and pinene degradation
ttj01100  Metabolic pathways
ttj01110  Biosynthesis of secondary metabolites
ttj01120  Microbial metabolism in diverse environments
ttj01130  Biosynthesis of antibiotics
ttj01212  Fatty acid metabolism
Module
ttj_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ttj00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    TTHA0218
   00650 Butanoate metabolism
    TTHA0218
  Lipid metabolism
   00071 Fatty acid degradation
    TTHA0218
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    TTHA0218
   00310 Lysine degradation
    TTHA0218
   00360 Phenylalanine metabolism
    TTHA0218
   00380 Tryptophan metabolism
    TTHA0218
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    TTHA0218
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    TTHA0218
   00281 Geraniol degradation
    TTHA0218
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    TTHA0218
   00627 Aminobenzoate degradation
    TTHA0218
   00930 Caprolactam degradation
    TTHA0218
Enzymes [BR:ttj01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     TTHA0218
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-GeneID: 3168083
NCBI-ProteinID: YP_143484
UniProt: Q5SLS5
Structure
PDB: 

Jmol
Position
213747..214541
Genome map
AA seq 264 aa AA seqDB search
MLASLEARYPGLAFAWPRPGVLEITFRGEKLNAMPPALHRGLARVWRDLEAVEGVRAVLL
RGEGGVFSAGGSFGLIEEMRASHEALLRVFWEARDLVLGPLNFPRPVVAAVEKVAVGAGL
ALALAADIAVVGKGTRLLDGHLRLGVAAGDHAVLLWPLLVGMAKAKYHLLLNEPLTGEEA
ERLGLVALAVEDEKVYEKALEVAERLAQGPKEALHHTKHALNHWYRSFLPHFELSLALEF
LGFSGKELEEGLKALKEKRPPEFP
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgctggcctctttggaagcccgctacccggggctcgccttcgcctggccgaggcccggc
gtcctggagatcaccttccgcggggagaagctcaacgccatgccccctgccctccaccgg
ggcctggcccgggtgtggcgggacctcgaggcggtggagggcgtaagggccgtgctcctt
cggggcgagggcggggtcttctccgccgggggctccttcggcctcattgaggagatgcgg
gcctcccacgaggccctcctccgggtcttctgggaggccagggacctcgtgctcggaccc
ctcaacttcccgaggcccgtggtggcggcggtggagaaggtggcggtgggggcggggctt
gccctggccctcgccgccgacattgccgtggtggggaaggggacgaggcttcttgacggc
cacctccgcctcggggtggcggcgggggaccacgccgtcctcctctggcccctcctcgtg
ggcatggccaaggccaagtaccacctcctcctgaacgagcccctcacgggggaggaggcg
gagcgcctgggcctcgtggccttggcggtggaggacgaaaaggtctacgagaaggccctc
gaggtggcggaaaggctcgcccaaggccccaaggaggccctacaccacaccaagcacgcc
ttaaaccactggtaccggagcttcctcccccactttgagctctccttggccttggagttt
ttggggttttccgggaaggagctggaggagggcctcaaggccctcaaggagaagcgcccc
cccgagttcccatga

DBGET integrated database retrieval system