KEGG   Thermus thermophilus HB8: TTHA0233Help
Entry
TTHA0233          CDS       T00220                                 

Definition
(RefSeq) pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component
  KO
K00382  
dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
ttj  Thermus thermophilus HB8
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Glycine, serine and threonine metabolism
Valine, leucine and isoleucine degradation
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ttj00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TTHA0233
   00020 Citrate cycle (TCA cycle)
    TTHA0233
   00620 Pyruvate metabolism
    TTHA0233
   00630 Glyoxylate and dicarboxylate metabolism
    TTHA0233
   00640 Propanoate metabolism
    TTHA0233
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TTHA0233
   00280 Valine, leucine and isoleucine degradation
    TTHA0233
Enzymes [BR:ttj01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     TTHA0233
Exosome [BR:ttj04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   TTHA0233
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Structure
PDB: 

Jmol
Position
225850..227244
Genome map
AA seq 464 aa AA seqDB search
MTPMKTYDLIVIGTGPGGYHAAIRAAQLGLKVLAVEAGEVGGVCLNVGCIPTKALLHAAE
TLHHLKVAEGFGLKAKPELDLKKLGGWRDQVVKKLTGGVGTLLKGNGVELLRGFARLVGP
KEVEVGGERYGAKSLILATGSEPLELKGFPFGEDVWDSTRALKVEEGLPKRLLVIGGGAV
GLELGQVYRRLGAEVTLIEYMPEILPQGDPETAALLRRALEKEGIRVRTKTKAVGYEKKK
DGLHVRLEPAEGGEGEEVVVDKVLVAVGRKPRTEGLGLEKAGVKVDERGFIRVNARMETS
VPGVYAIGDAARPPLLAHKAMREGLIAAENAAGKDSAFDYQVPSVVYTSPEWAGVGLTEE
EAKRAGYKVKVGKFPLAASGRALTLGGAEGMVKVVGDEETDLLLGVFIVGPQAGELIAEA
ALALEMGATLTDLALTVHPHPTLSESLMEAAEAFHKQAIHILNR
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgacgcctatgaagacctacgacctcatcgtgatcggcaccggcccggggggctaccac
gccgccatccgggccgcccagctcggcctcaaggtgctggcggtggaggcgggcgaggtg
gggggggtctgcctcaacgtgggctgcatccccaccaaggccctcctccacgccgccgag
accctccaccacctgaaggtggccgaggggttcggcctgaaggccaagccggagctggac
ctgaagaagctcggcggctggcgggatcaggtggtgaaaaagctcaccgggggcgtgggc
accctcctcaaggggaacggggtggagctcctcaggggcttcgcccgcttggtgggcccc
aaggaggtggaggtagggggcgagcgttacggggcaaaaagcctgatcctcgccacgggg
agcgaacccctggagctcaagggcttccccttcggcgaggacgtctgggactccacccgg
gcccttaaggtagaggagggcctccccaagcgcctcctggtcatcggcgggggggcggtg
ggcctcgagctcggccaggtctaccgccgcctgggcgcggaggtcaccctcattgagtac
atgccggagatcctcccccagggcgaccccgagaccgccgccctcctaaggcgcgccctg
gaaaaggaggggataagggttcgcaccaagaccaaggccgtgggctacgagaagaagaag
gacggcctccacgtgcgcctcgagcccgccgagggcggcgagggggaggaggtggtggtg
gacaaggtcctggtggccgtgggccggaagccccgcacggagggcctgggcctggagaag
gccggggtcaaggtggacgagcggggcttcatccgggtgaacgcccggatggagacgagc
gtccccggggtctacgccatcggcgacgcggcccgcccccccctcctcgcccacaaggcc
atgcgggaggggctcatcgccgccgagaacgccgccggcaaggacagcgcctttgactac
caggtcccgagcgtggtctacacctcccccgagtgggccggggtgggcctcaccgaggag
gaagcgaagcgggcgggctacaaggtgaaggtggggaagttccccctcgccgccagtggc
cgggccctcaccctgggcggggccgaggggatggtcaaggtggtgggggacgaggagacg
gacctcctcctcggggtcttcatcgtggggccccaggcgggggagctcatcgccgaggcc
gccttggccctggagatgggggccacgctcaccgacctcgccctcaccgtccacccccac
cccaccctctcggaaagcctcatggaggcggcggaggccttccacaagcaggccatccac
atcctgaaccgctag

DBGET integrated database retrieval system