KEGG   Thermus thermophilus HB8: TTHA0291Help
Entry
TTHA0291          CDS       T00220                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
ttj  Thermus thermophilus HB8
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ttj00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    TTHA0291 (ruvA)
Enzymes [BR:ttj01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     TTHA0291 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
283854..284429
Genome map
AA seq 191 aa AA seqDB search
MIRYLRGLVLKKEAGGFVLLAGGVGFFLQAPTPFLQALEEGKEVGVHTHLLLKEEGLSLY
GFPDEENLALFELLLSVSGVGPKVALALLSALPPRLLARALLEGDARLLTSASGVGRRLA
ERIALELKGKVPPHLLAGEKVESEAAEEAVMALAALGFKEAQARAVVLDLLAQNPKARAQ
DLIKEALKRLR
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgatccgctacctccggggcctggtcctcaagaaggaggcgggcggcttcgtccttctc
gccgggggggtggggttcttcctccaggcccccacgcccttcctccaggccctggaggag
gggaaggaggtgggggtccacacccacctcctcctcaaggaggaggggctgtccctctac
ggcttccccgacgaggagaacctcgccctctttgaactcctcctctcggtgagcggcgtg
gggcccaaggtggccctcgccctcctctcggccctgccccctaggctcctcgcccgggcc
ctcctggagggggacgcgaggctcctcacctcggcgagcggggtggggagaaggctcgcc
gaaaggatcgccctggagctcaaggggaaggtgcccccccacctcctcgccggggagaag
gtggagagcgaggccgcggaggaggcggtgatggccctcgccgccttggggttcaaggag
gcccaggcgcgggcggtggtcctggacctcctggcccaaaaccccaaggcccgggcccag
gacctcatcaaggaggccctaaagcgcctccgctag

DBGET integrated database retrieval system