KEGG   Thermus thermophilus HB8: TTHA0291Help
Entry
TTHA0291          CDS       T00220                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
ttj  Thermus thermophilus HB8
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:ttj03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
283854..284429
Genome map
AA seq 191 aa AA seqDB search
MIRYLRGLVLKKEAGGFVLLAGGVGFFLQAPTPFLQALEEGKEVGVHTHLLLKEEGLSLY
GFPDEENLALFELLLSVSGVGPKVALALLSALPPRLLARALLEGDARLLTSASGVGRRLA
ERIALELKGKVPPHLLAGEKVESEAAEEAVMALAALGFKEAQARAVVLDLLAQNPKARAQ
DLIKEALKRLR
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgatccgctacctccggggcctggtcctcaagaaggaggcgggcggcttcgtccttctc
gccgggggggtggggttcttcctccaggcccccacgcccttcctccaggccctggaggag
gggaaggaggtgggggtccacacccacctcctcctcaaggaggaggggctgtccctctac
ggcttccccgacgaggagaacctcgccctctttgaactcctcctctcggtgagcggcgtg
gggcccaaggtggccctcgccctcctctcggccctgccccctaggctcctcgcccgggcc
ctcctggagggggacgcgaggctcctcacctcggcgagcggggtggggagaaggctcgcc
gaaaggatcgccctggagctcaaggggaaggtgcccccccacctcctcgccggggagaag
gtggagagcgaggccgcggaggaggcggtgatggccctcgccgccttggggttcaaggag
gcccaggcgcgggcggtggtcctggacctcctggcccaaaaccccaaggcccgggcccag
gacctcatcaaggaggccctaaagcgcctccgctag

DBGET integrated database retrieval system