KEGG   Thermus thermophilus HB8: TTHA0431Help
Entry
TTHA0431          CDS       T00220                                 

Definition
sugar kinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
ttj  Thermus thermophilus HB8
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:ttj00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    TTHA0431
Enzymes [BR:ttj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     TTHA0431
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(406137..407057)
Genome map
AA seq 306 aa AA seqDB search
MRFFVLGDVSVDLLFFLERIPEPGEEVPSRRALMKPGGAGGTLAAQLASLGHRVFLAGRV
GKDPFAELALSRVREVGVDLRHLQEDPEHTTSSVLILVVPGGERAMVSAEGASRYLDPAL
FKPRFLDQVDAVVLSAYALVGGPSRSYAAEVLEAARRRELPVFADLGAGAVRAAGKELLK
HLRGVGWLLMNEGELKTLTGASSISQGVARLRQEGFQHLAVKVGAMGSIVVTPEGEELIE
PFPVEDIVDSTGAGDAYTAAFAHAILEGLSPVEAGRLANLAGALAATAIGAQGRLVTLED
LKVAAG
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgcggttcttcgtgttgggagacgtttccgtggacctcctcttcttcctggagcgcatc
cccgagccgggggaggaggtgccctcgaggcgggccctgatgaagccgggaggggccggg
ggaaccttggcggcccagctcgcaagcctaggccaccgggtctttctggcgggccgggtg
gggaaggaccccttcgccgagctcgccctaagccgggtgcgggaggtgggggtggacctc
cgccacctccaggaggacccggagcacaccacgagctccgtcctcatcctggtggtcccc
gggggggagcgggccatggtgagcgccgagggggcgagccgctacctggacccggccctc
ttcaagccccgcttcctggaccaggtggacgccgtggtcctctccgcctacgccctggtg
ggggggccttcccggagctacgccgccgaggtcctcgaggcggcgcgaaggcgggagctc
cccgttttcgccgacctcggggccggggcggtgcgggccgcgggaaaggagctcctgaag
cacctccggggggtgggctggctcctcatgaacgagggggagctcaagaccctcaccggg
gcctcctccatctcccagggggtggcgaggctccgccaggaggggttccagcacctcgcc
gtcaaggtgggggccatgggctccatcgtggtcaccccggagggggaggagctcattgag
cccttccccgtggaggacatcgtggactccacgggggccggggacgcctacaccgccgcc
ttcgcccacgccatcctggaaggcctaagccccgtggaggcgggccgcctggccaacctg
gcgggcgccttggccgccaccgccatcggggcccaggggcggctcgtcaccctagaggac
ctcaaagtagcggcgggctag

DBGET integrated database retrieval system