KEGG   Thermus thermophilus HB8: TTHA0491Help
Entry
TTHA0491          CDS       T00220                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
ttj  Thermus thermophilus HB8
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ttj00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TTHA0491
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TTHA0491
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    TTHA0491
Enzymes [BR:ttj01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     TTHA0491
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
459060..460115
Genome map
AA seq 351 aa AA seqDB search
MRPPLIERYRNLLPVSEKTPVISLLEGSTPLIPLKGPEEARKKGIRLYAKYEGLNPTGSF
KDRGMTLAVSKAVEGGAQAVACASTGNTAASAAAYAARAGILAIVVLPAGYVALGKVAQS
LVHGARIVQVEGNFDDALRLTQKLTEAFPVALVNSVNPHRLEGQKTLAFEVVDELGDAPH
YHALPVGNAGNITAHWMGYKAYHALGKAKRLPRMLGFQAAGAAPLVLGRPVERPETLATA
IRIGNPASWQGAVRAKEESGGVIEAVTDEEILFAYRYLAREEGIFCEPASAAAMAGVFKL
LREGRLEPESTVVLTLTGHGLKDPATAERVAELPPPVPARLEAVAAAAGLL
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgcggccgcccctcatagagcgctaccggaacctcctcccggtctcggagaagacgccg
gtgataagcctcctggagggctccacccccctcatcccccttaagggcccggaggaggcg
aggaagaagggcatccgcctctacgccaagtacgagggcttaaaccccacgggaagcttc
aaggaccgggggatgaccctcgccgtctccaaggcggtggaagggggggcccaggccgtc
gcctgcgccagcaccgggaacaccgccgcctccgccgccgcctacgccgcaagggccggg
attttggccatcgtggtcctccccgcggggtacgtggccttgggcaaggtggcccagagc
ctggtgcacggggcgaggatcgtccaggtggaggggaactttgacgacgccctgcgcctc
acccaaaagctgacggaggccttccccgtggccctggtgaactccgtgaacccccaccgc
ctggagggccagaagaccctggcctttgaggtggtggacgagctcggcgacgccccccac
taccacgccctccccgtggggaacgcggggaacatcaccgcccactggatgggctacaaa
gcgtaccacgccctgggcaaggccaaaaggcttcccagaatgctcggcttccaggcggcg
ggggcggcccccttggtcctgggccgcccggtggagcgccccgagaccctggccaccgcc
atccgcatcggcaacccggcgagctggcaaggggccgtgcgggccaaggaggagtcgggg
ggggtcatagaggcggtgacggacgaggagatcctcttcgcctaccgctacctggcccgg
gaggaagggatcttctgcgagcccgcaagcgccgccgccatggcgggggtcttcaagctg
ttgcgggagggtaggcttgagccggagagcaccgtggtcctcaccctcacgggccacggc
ctcaaggacccggccaccgccgagagggtggccgagcttcccccgcccgtgcccgcccgc
ctcgaggcggtggccgcggccgcggggcttttgtga

DBGET integrated database retrieval system