KEGG   Thermus thermophilus HB8: TTHA0599Help
Entry
TTHA0599          CDS       T00220                                 

Definition
protoporphyrinogen oxidase HemG
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
ttj  Thermus thermophilus HB8
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ttj00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    TTHA0599
Enzymes [BR:ttj01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     TTHA0599
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(566153..567526)
Genome map
AA seq 457 aa AA seqDB search
MAEIGVAVVGGGWAGLAAALALKEAGADFLLLEASLRLGGKVRTARQEGFLVEGGPDASV
RYKKEVLELAQAFGLEPIGTLPEKPAAYILYRGKRHPLPEGLLQVVPGDLKALARTPLLS
LPGKLRALYDLFLPRGAKEDETLREFVERRLGPEVYRALVAPLAGGVYGGEPDDLSMRAA
FPQLWELEGRHRSLLLGAMRVRKGRGSREGGSLFFSFAEGLQALTRRMAEALGERVLRGT
PVLGLEPARGRWRLHTPKGALLAEAVVLAIPAPQAAGLLRPFLPEATALLKGIPHTPAAT
VSLAFPGALPVEGHGLLVAKGEGLRARGFTWTHRKWPGRVPEGFSLVRAYFSGEAARLSE
EALIRLALEDLARLLPGLPRVHRAWAFRFPEGMPAYRVGHLDRVERLEMALVKAPGLFLA
GNYLQGVGLPEVVRSGRRAAQRALAHLSLGEAHGASR
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
gtggccgagataggggtggccgtggtgggcggggggtgggcggggctggccgccgccctg
gccctcaaggaggcgggggcggacttcctcctcctggaggccagcctccgcctcgggggg
aaggtgcgcaccgcccggcaggagggcttcctggtggagggggggcctgacgccagcgtc
cgctacaagaaggaggtgctggagctcgcccaggccttcggcctcgagcccatcggcacc
cttccggaaaagcccgcggcctacatcctctaccgggggaagcgccaccccctgcccgaa
ggcctcctccaggtggtgcccggggacctcaaggccctggcccgcacccccctcctctcc
ctcccggggaagctccgggccctctacgacctcttcctcccccggggggcgaaggaggac
gagaccctgagggagttcgtggagaggcgcctggggcccgaggtctaccgggccctggtg
gcccccctggccgggggggtgtacgggggggagcccgacgacctctccatgcgggccgcc
tttccccagctctgggagctggagggaaggcaccggagcctcctccttggggccatgcgg
gtccggaaggggcggggaagccgggaggggggcagcctcttcttctccttcgccgagggc
ctccaggccctcacccggcggatggccgaggccctgggggagcgggtcctgcggggcacc
cctgtcctcggcctggagccagcccgcggaaggtggcgcctccacacccctaaaggggcc
ctcctcgccgaggccgtggtcctcgccatccccgccccccaggcggcgggcctcctcagg
cccttcctcccggaggccaccgctttgctcaaggggatcccccacaccccggcggccacg
gtgagcctggccttccccggggcgctccccgtggaggggcacgggctgcttgtggccaag
ggggaggggcttcgggcccgggggttcacctggacgcaccggaagtggccggggcgggtc
ccggaggggttcagcctggtgcgggcctacttctcgggggaggccgcccggctttccgag
gaggccctcatccggcttgccctggaggacctagcccgcctcctcccgggccttccccgg
gtccaccgggcctgggccttccgcttccccgaggggatgcccgcctaccgggtgggccac
ctggaccgggtggagcggctggagatggccctggtcaaggcgcccggcctcttcctcgcg
gggaactacctccagggggtgggcctgcccgaggtggtgcgctcggggaggcgggcggcg
caaagggccctggcccacctctccctaggcgaggcccatggagcttctcggtga

DBGET integrated database retrieval system