KEGG   Thermus thermophilus HB8: TTHA0634Help
Entry
TTHA0634          CDS       T00220                                 

Definition
magnesium chelatase
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
ttj  Thermus thermophilus HB8
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ttj00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    TTHA0634
Enzymes [BR:ttj01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     TTHA0634
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
603865..605259
Genome map
AA seq 464 aa AA seqDB search
MKAKTLGELRRTYPLEKLRRTVKDEARENLREKLRRGERLFPGIHGYEDTVIPALVQAIL
AKQNFILLGTRGQAKSRILRSLTSLLDEEVPALATELRDNPLHPISPEGKRLLEEAGDDA
PIVWLSREDRYVEKLATPDTTVADLLGDMDPIKAARRGTGMADLESIHYGLLPRANRGIF
AVNELADLAPKVQVALFNILEEGDVQIRGYPLRLPLDVWLVFTANPQDYTARGRIVTPLK
DRIGSEIRTHYPRSLEEGARISAQEAYVPEGVLVPEWVRLSVEAVAFVAREDRRVDQTAG
VSQRLAISLLEVVAASAERRALLHGGRPVARPLDLYQGLPAITGKLELEYEGELQGAERV
AREIVQRAFGLVLPRYRLRTEPIVAHFEEGNLLTLPEGDVEEALKAMAGVPGLLEAARAL
AEGEAPEVLLSAGEFVLEGLVGRRKLSRGEATYQAAERPRSYGN
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
gtgaaggccaagaccctaggcgaactcaggcgcacctaccccctggagaagctccgccgc
accgtgaaggacgaggccagggagaacctccgggagaagctcaggcgcggggagaggctt
ttccccggcatccacggctacgaggacacggtgatccccgccctggtccaggccatcctc
gccaagcagaacttcatcctcctcggcacccggggccaggcgaaaagccggatcctgcga
agcctcacgagcctcctggacgaggaggttcccgccctcgccacggagcttcgcgacaac
cccctccaccccatctcccccgagggaaagcgcctcctggaggaggccggggacgacgcc
cccatcgtctggctttcccgggaggaccggtacgtggagaagctcgccacccccgacacc
accgtggccgacctcctcggggacatggaccccatcaaggcggccaggcggggcacgggg
atggcggacctggagagcatccactacggcctcctgccccgggcgaaccgggggatcttc
gccgtgaacgagctcgccgacctcgcccccaaggtgcaggtggccctcttcaacatcctc
gaggaaggggacgtccagatccggggctaccccctccggcttcccctggacgtctggctc
gtcttcaccgccaacccccaggactacaccgcccggggccgcatcgtgacccccctcaag
gaccggatcgggagcgagatccgcacccactacccccgctccttggaggagggggcccgg
atcagcgcccaggaggcctacgtgccggagggggtcctggtcccggagtgggtgaggctt
tccgtggaggccgtggccttcgtcgcccgggaggaccgccgcgtggaccagacggcgggg
gtctcccagcgcctcgccatcagccttttggaggtggtggcggcaagcgccgagcgccgc
gccctcctccacgggggaaggcccgtggcgaggcctttggacctctaccaggggcttccc
gccatcaccgggaagctggaattggagtacgagggggagctccagggggcggagagggtg
gcgcgggagatcgtgcagcgggccttcggcctggtcctcccccgctaccgcttaaggacc
gagcccatcgtggcccactttgaggagggaaacctcctcaccctgcccgagggggacgtg
gaggaggcccttaaggccatggccggggtcccggggcttctggaggcggcgagggccctg
gccgagggggaagcccctgaggttttgctttccgccggggagttcgtcctggaaggcctg
gtgggccgaaggaagctctcccggggcgaggcgacctaccaggcggcggagcgcccgagg
agctatggcaactag

DBGET integrated database retrieval system