KEGG   Thermus thermophilus HB8: TTHA0722Help
Entry
TTHA0722          CDS       T00220                                 

Gene name
hisD
Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
ttj  Thermus thermophilus HB8
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ttj01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:ttj00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
684200..685438
Genome map
AA seq 412 aa AA seqDB search
MIYAAEEVRARFARRGLSFDPTVEEIVRGILEAVREEGDEALDRFSRDLDGYPVEEVPKR
AWREAYEDLDEDLRDALETARERIEAFYREEARGGFLRAEGGGVLAQLVRPLERVGVYVP
GGSAPLLSTLLMTVVPAKVAGVREVIVASPPKVHPGVLAAAWVAGADRLFAMGGAQAIAA
LAYGTGRVPRVDKIVGPGNRYVVAAKRLVYGTVGIDGLAGPTETMIIADGSASPRLLAAD
LLAQAEHGPDSEPWLLSPDRALLERVEAELSWQLQDLPRAEVARQALEKGGLVLTKDLEE
AFALANLYAPEHLSLALSDPLPWLEKVQNAGGVFLGEGSPEALGDYIAGPSHVMPTSGTA
RFQGGLAVRDFLKVIPVVGLSEGAARELAKKGALLARAEGLEGHARSLDLRR
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgatctacgctgccgaggaggtgcgggcccgcttcgcccgccggggcctctcctttgac
cccacggtggaggagatcgtgcggggcatcctggaggcggtccgggaggaaggggacgag
gccctggaccggttcagccgggacctggacggctacccggtggaggaggtccccaagcgg
gcctggcgggaggcctacgaggacttggacgaggacctcagggacgccctggagacggcc
cgggagcgcatagaggccttctaccgggaggaggcccggggcggcttcctccgggccgag
gggggcggggtgctggcccagctcgtccgccccctggagcgggtgggggtctacgtcccc
gggggaagcgcccccctcctctccaccctcctcatgaccgtggtcccggccaaggtggcg
ggggtgcgggaggtgatcgtggcgagcccccccaaggtccaccccggggtcctggccgcc
gcctgggtggcgggggccgaccgcctcttcgccatgggcggggcccaggccatcgccgcc
ttggcctacggcacggggcgcgtcccccgggtggacaagatcgtggggccggggaaccgc
tacgtggtggcggcgaagaggctcgtctacggcaccgtgggcattgacggcctcgccggc
cccacggagaccatgatcatcgccgacggctccgcctcccccaggctcctcgccgccgac
ctcctggcccaggcggagcacggccccgactccgagccctggctcctctccccggaccgg
gccctgttggaacgggtggaggccgagctttcctggcagctccaggacctcccccgggcc
gaggtggcccgtcaggccctggagaagggcgggctcgtcctcaccaaggacctggaggag
gccttcgccctcgccaacctctacgcccccgagcacctctccctcgccctctcggacccc
cttccctggctggagaaggtgcagaacgccgggggggtcttcctgggggaggggagcccc
gaggccttgggcgactacatcgccgggcccagccacgtcatgcccacctcggggacggcc
cgcttccagggggggttggcggtgcgggacttcctgaaggtgatcccggtggtgggcctt
tccgagggcgcggcccgggagctcgccaagaagggggcgcttttggcccgggcggagggc
ctcgagggccacgcccgctccctggacctcaggcgatga

DBGET integrated database retrieval system