KEGG   Thermus thermophilus HB8: TTHA0947Help
Entry
TTHA0947          CDS       T00220                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ttj  Thermus thermophilus HB8
Pathway
ttj00010  Glycolysis / Gluconeogenesis
ttj00051  Fructose and mannose metabolism
ttj00562  Inositol phosphate metabolism
ttj00710  Carbon fixation in photosynthetic organisms
ttj01100  Metabolic pathways
ttj01110  Biosynthesis of secondary metabolites
ttj01120  Microbial metabolism in diverse environments
ttj01130  Biosynthesis of antibiotics
ttj01200  Carbon metabolism
ttj01230  Biosynthesis of amino acids
Module
ttj_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ttj_M00002  Glycolysis, core module involving three-carbon compounds
ttj_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ttj00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TTHA0947 (tpiA)
   00051 Fructose and mannose metabolism
    TTHA0947 (tpiA)
   00562 Inositol phosphate metabolism
    TTHA0947 (tpiA)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    TTHA0947 (tpiA)
Enzymes [BR:ttj01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     TTHA0947 (tpiA)
Exosome [BR:ttj04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   TTHA0947 (tpiA)
  Exosomal proteins of bladder cancer cells
   TTHA0947 (tpiA)
  Exosomal proteins of melanoma cells
   TTHA0947 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-GeneID: 3169211
NCBI-ProteinID: YP_144213
UniProt: Q5SJR1
Structure
PDB: 

Jmol
Position
complement(893277..894029)
Genome map
AA seq 250 aa AA seqDB search
MRRVLVAGNWKMHKTPSEARVWFAELKRLLPPLQSEAAVLPAFPILPVAKEVLAETQVGY
GAQDVSAHKEGAYTGEVSARMLSDLGCRYAIVGHSERRRYHGETDALVAEKAKRLLEEGI
TPILCVGEPLEVREKGEAVPYTLRQLRGSLEGVEPPGPEALVIAYEPVWAIGTGKNATPE
DAEAMHQAIRKALSERYGEAFASRVRILYGGSVNPKNFADLLSMPNVDGGLVGGASLELE
SFLALLRIAG
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgcggcgcgtcttggtggcgggcaactggaaaatgcacaaaacgccctccgaggccagg
gtgtggttcgccgagctcaagaggctccttccccccctgcagtcggaggccgccgtcctc
cccgccttccccatcctccccgtggccaaggaggtgctggccgaaacccaggtgggctac
ggggctcaggacgtctccgcccacaaggagggggcctacacgggggaggtttcggcacgg
atgctttccgacctcggttgccgctacgccatcgtgggccactcggagcgaaggcgctac
cacggggagacggacgccctggtggcggagaaggccaagaggcttctggaggaggggatc
acccccatcctctgcgtgggggaacccttggaggtgcgggaaaagggcgaggccgtgccc
tacaccttgaggcaactccgggggagcctcgagggggtggagccccctggcccagaggcc
ctcgtcatcgcctacgagcccgtgtgggccatcggcacgggcaaaaacgccacccccgag
gacgccgaggccatgcaccaggcgatccgcaaggccctttccgagcggtacggggaggcc
ttcgcgagccgggttcgcatcctctacggaggaagcgtcaaccccaagaacttcgccgac
ctcctctccatgcccaacgtggacggggggctcgtgggcggggcgagcctggagctggaa
agcttcctcgccctcctcaggatcgcgggttag

DBGET integrated database retrieval system