KEGG   Thermus thermophilus HB8: TTHA0947Help
Entry
TTHA0947          CDS       T00220                                 

Gene name
tpiA
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ttj  Thermus thermophilus HB8
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ttj00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TTHA0947 (tpiA)
   01230 Biosynthesis of amino acids
    TTHA0947 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TTHA0947 (tpiA)
   00051 Fructose and mannose metabolism
    TTHA0947 (tpiA)
   00562 Inositol phosphate metabolism
    TTHA0947 (tpiA)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    TTHA0947 (tpiA)
Enzymes [BR:ttj01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     TTHA0947 (tpiA)
Exosome [BR:ttj04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   TTHA0947 (tpiA)
  Exosomal proteins of bladder cancer cells
   TTHA0947 (tpiA)
  Exosomal proteins of melanoma cells
   TTHA0947 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(893277..894029)
Genome map
AA seq 250 aa AA seqDB search
MRRVLVAGNWKMHKTPSEARVWFAELKRLLPPLQSEAAVLPAFPILPVAKEVLAETQVGY
GAQDVSAHKEGAYTGEVSARMLSDLGCRYAIVGHSERRRYHGETDALVAEKAKRLLEEGI
TPILCVGEPLEVREKGEAVPYTLRQLRGSLEGVEPPGPEALVIAYEPVWAIGTGKNATPE
DAEAMHQAIRKALSERYGEAFASRVRILYGGSVNPKNFADLLSMPNVDGGLVGGASLELE
SFLALLRIAG
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgcggcgcgtcttggtggcgggcaactggaaaatgcacaaaacgccctccgaggccagg
gtgtggttcgccgagctcaagaggctccttccccccctgcagtcggaggccgccgtcctc
cccgccttccccatcctccccgtggccaaggaggtgctggccgaaacccaggtgggctac
ggggctcaggacgtctccgcccacaaggagggggcctacacgggggaggtttcggcacgg
atgctttccgacctcggttgccgctacgccatcgtgggccactcggagcgaaggcgctac
cacggggagacggacgccctggtggcggagaaggccaagaggcttctggaggaggggatc
acccccatcctctgcgtgggggaacccttggaggtgcgggaaaagggcgaggccgtgccc
tacaccttgaggcaactccgggggagcctcgagggggtggagccccctggcccagaggcc
ctcgtcatcgcctacgagcccgtgtgggccatcggcacgggcaaaaacgccacccccgag
gacgccgaggccatgcaccaggcgatccgcaaggccctttccgagcggtacggggaggcc
ttcgcgagccgggttcgcatcctctacggaggaagcgtcaaccccaagaacttcgccgac
ctcctctccatgcccaacgtggacggggggctcgtgggcggggcgagcctggagctggaa
agcttcctcgccctcctcaggatcgcgggttag

DBGET integrated database retrieval system