KEGG   Thermus thermophilus HB8: TTHA0980Help
Entry
TTHA0980          CDS       T00220                                 

Definition
hypothetical protein
Orthology
K01622  
fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
ttj  Thermus thermophilus HB8
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:ttj01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:ttj01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ttj00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:ttj00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:ttj00051]
Metabolism; Energy metabolism; Methane metabolism [PATH:ttj00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(923847..924938)
Genome map
AA seq 363 aa AA seqDB search
MKVTLSVLKADIGSVGGHTLPSRKVLAKVEEVVREEVGRLLLDAYVFHIGDDIVLLLSHT
RGVRNQEVHALAWKAFREGTEVAKAEGLYGAGQDLLKDAFTGNLHGLGPQVAEMEFTERP
AEPFMVLAADKTEPGAFNLPLYLAFADPMYSSGLLLSPELRPGFRFRIMDLAQTERDSYI
ELDAPERLYDIATLLRDSHRFAIESIWSRKHGEQAAVVSTTRLRNIAGRYVGKDDPVAIV
RTQKIFPATEEFGPVFALAPYVAGDTRGSHHMPLMPVRANTPASTFFCVPMVCGLAFSLR
EGRLSEPVDLFADPVWEAVRAKVVEKAQEMRRQGFYGPAMLPMEELEYTGIAERLKALER
EFS
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtcaccttgagcgtgctcaaggcggacatcggctcggtgggcgggcacaccctg
cccagccgcaaggtcctcgccaaggtggaggaggtggttcgggaggaggtgggccgcctc
ctcctggacgcctacgtcttccacatcggcgacgacatcgtcctcctcctatcccacacc
cggggggtgcggaaccaggaggtgcacgccctggcctggaaggccttccgcgagggcacc
gaggtggccaaggccgaaggcctctacggggcgggccaggacctcctcaaggacgccttc
acggggaacctccacggccttgggccccaggtggcggagatggagttcaccgagcgcccc
gcggagcccttcatggtcctcgccgccgacaagacggagcccggggccttcaacctcccc
ctctacctggccttcgccgaccccatgtactcctcgggcctcctcctttccccggagctt
aggcccggcttccgcttccgcatcatggacttggcccagacggagcgggacagctacatt
gagctggacgcccccgagcgcctctacgacatcgccaccctccttcgcgactcccaccgc
ttcgccatagagtccatctggtcccggaagcacggggagcaggccgccgtggtgagcacc
acgcgcctgaggaacatcgccgggcgctacgtgggcaaggacgaccccgtggccatcgtc
cgcacccagaagatcttccccgccacggaggagttcggccccgtcttcgccctcgccccc
tacgtggcgggggacacccggggaagccaccacatgcccctgatgcccgtgcgggccaac
accccggcctccaccttcttctgcgtgcccatggtgtgcggcctggccttctccttgcgg
gaggggcggctttccgagcccgtggacctcttcgccgaccccgtgtgggaggcggtgcgg
gccaaggtggtggagaaggcccaggagatgcgccgccagggcttctacggccccgccatg
cttcccatggaggagctggagtacacggggatcgccgagcggctgaaggctttggagcgg
gagttcagttaa

DBGET integrated database retrieval system