KEGG   Thermus thermophilus HB8: TTHA1094Help
Entry
TTHA1094          CDS       T00220                                 

Gene name
trpA
Definition
(RefSeq) tryptophan synthase subunit alpha (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ttj  Thermus thermophilus HB8
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ttj00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TTHA1094 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TTHA1094 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    TTHA1094 (trpA)
Enzymes [BR:ttj01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     TTHA1094 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(1039965..1040780)
Genome map
AA seq 271 aa AA seqDB search
MTTLEAFAKARSEGRAALIPYLTAGFPSREGFLQAVEEVLPYADLLEIGLPYSDPLGDGP
VIQRASELALRKGMSVQGALELVREVRALTEKPLFLMTYLNPVLAWGPERFFGLFKQAGA
TGVILPDLPPDEDPGLVRLAQEIGLETVFLLAPTSTDARIATVVRHATGFVYAVSVTGVT
GMRERLPEEVKDLVRRIKARTALPVAVGFGVSGKATAAQAAVADGVVVGSALVRALEEGR
SLAPLLQEIRQGLQRLEANPGLKESSKKPLP
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
gtgaccaccctcgaggccttcgccaaggcccggtccgagggccgggccgccctcatccct
tacctcaccgcgggcttccccagccgggagggctttttgcaggcggtggaggaggtcctc
ccctatgccgaccttctggagatcggcctcccctactccgaccccctgggggacggcccc
gtgatccagcgggcaagcgaactggccctgaggaaggggatgagcgtccaaggcgctttg
gagctcgtccgcgaggtgcgcgccctcacggagaaacccctcttcctcatgacctacctg
aaccccgtcctggcctgggggccggagcgcttcttcggcctcttcaagcaggcgggggcc
acgggggtgatccttcccgacctcccccccgacgaggacccaggcctcgtgcgcctcgcc
caggagatcggcctggagacggtcttccttctcgcccccacctccacggacgcccgcatc
gccaccgtggtccgccacgccacgggcttcgtctacgccgtctccgtcaccggggtcacg
gggatgcgggaaaggcttcccgaggaggtcaaggacctggtgcggcgcatcaaggccagg
accgccctccccgtggccgtgggcttcggggtttccggcaaggccacggccgcacaggcg
gcggtggcggacggggtggtggtgggaagcgccttggtccgggccttggaggaggggagg
tcccttgcgccccttctccaggagatccgccagggcctccagcgcctcgaggccaacccc
ggcctgaaggaaagctcaaagaagccgttgccctga

DBGET integrated database retrieval system