KEGG   Thermus thermophilus HB8: TTHA1164Help
Entry
TTHA1164          CDS       T00220                                 

Gene name
trpC
Definition
(RefSeq) indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
ttj  Thermus thermophilus HB8
Pathway
ttj00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ttj01100  Metabolic pathways
ttj01110  Biosynthesis of secondary metabolites
ttj01130  Biosynthesis of antibiotics
ttj01230  Biosynthesis of amino acids
Module
ttj_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ttj00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    TTHA1164 (trpC)
Enzymes [BR:ttj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     TTHA1164 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS
Motif
Other DBs
NCBI-GeneID: 3168685
NCBI-ProteinID: YP_144430
UniProt: Q5SJ50
Structure
PDB: 

Jmol
Position
1107645..1108409
Genome map
AA seq 254 aa AA seqDB search
MRPDLSRVPGVLGEIARKRASEVAPYPLPEPPSVPSFKEALLRPGLSVIAEVKRQSPSEG
LIREVDPVEAALAYARGGARAVSVLTEPHRFGGSLLDLKRVREAVDLPLLRKDFVVDPFM
LEEARAFGASAALLIVALLGELTGAYLEEARRLGLEALVEVHTERELEIALEAGAEVLGI
NNRDLATLHINLETAPRLGRLARKRGFGGVLVAESGYSRKEELKALEGLFDAVLIGTSLM
RAPDLEAALRELVG
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgcggcccgacctttcccgcgtccccggggtcctgggggagatcgccaggaagcgggct
tccgaggtggccccctatccccttcccgagcccccttccgtgccctccttcaaggaggcc
ctcctccgcccggggctttccgtaatcgccgaggtcaagaggcaaagcccctcggaaggg
ctcatccgggaggtggacccggtggaggccgccttggcctacgcgcggggcggggcgagg
gcggtgagcgtcctcaccgaaccccaccgcttcgggggaagcctcttggacctcaagcgg
gtgcgcgaggcggtggaccttcccctccttaggaaggacttcgtggtggaccccttcatg
ctggaggaggcccgggccttcggggcgagcgccgccctcctcatcgtggcccttttgggg
gagcttacgggggcctacctggaggaggcgagaaggcttggcctcgaggccctggtggag
gtccacacggagagggagctggagatcgccctcgaggccggcgcggaggtcctcgggatc
aataaccgcgacctcgccaccctgcacatcaacctggagaccgccccccgcctcggccgc
ctggcgcgaaagcggggcttcggcggggtcttggtggcggagtcggggtattcccgaaag
gaggagctgaaagctctggaggggctttttgacgccgtcctcatcggcacgagcttgatg
cgggcgcccgatctggaggccgccttaagggagcttgtaggatag

DBGET integrated database retrieval system