KEGG   Thermus thermophilus HB8: TTHA1249Help
Entry
TTHA1249          CDS       T00220                                 

Definition
acetyl-coenzyme A synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
ttj  Thermus thermophilus HB8
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ttj00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TTHA1249
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TTHA1249
   00620 Pyruvate metabolism
    TTHA1249
   00640 Propanoate metabolism
    TTHA1249
  Energy metabolism
   00680 Methane metabolism
    TTHA1249
Enzymes [BR:ttj01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     TTHA1249
Lipid biosynthesis proteins [BR:ttj01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   TTHA1249
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1183723..1186257
Genome map
AA seq 844 aa AA seqDB search
MARKRGLSTVQQALRLLAYLADHPEGVGAKEVARLLGKSLSSAYALLHSLMEEGFVVKEE
GGFRLARQKPVPLEPTPLEEALEELYLRTRERCYLALLTPQGVRLKTRGRQGQLHPLGET
LPPEWHALALGKVLLAFGDFPLPPLTPKTPYTLTDPLALEEELKRVRASGLAVEMEEYAL
GVSGVAVPLLSPEGRLLGALGVKVPSRRFPFAFGRLARALAEVARVSAQVLPEEEAPTPP
PALPEPVRVERIDPPEALRRAANLPDPRAAHRASLEDPEAFWEGFARGFAWERPWKAVFR
REDRTWFAGGLTNVALNALDRHLPEKAQQVALLTLDGEGRLGKWTYKEVRELSSRLAGLF
RTLGVGRGDRVALYLPTGLEAALAALACARIGAVHAALPLGLGPEALRRRLEDLRPRLLV
AADAYFYRGQPVRVREVVEAAIQGLDLKVLWHVRGSPEFLERLYEARPAEPEPVPAAHPL
FLLPTSGSTGKPKGVVHGHGGYMVGVAWALRHVFDLKPGEVFHTTADLFWIVGHSFGLYA
PLLLGGTSLLVEDRPDHPSPGAFYERLAHLGVDVLLTSPAVLRTLRRHGEARPTGLRLAA
SVGEVLSPEIWRWTREHLAWPVDNWWQTELGAPALPRPPLPAKPGHVGLPLPGVEARVVD
EEGRPLPPGSKGHLVLGATGPAHMVDLQGGRSPWRGGLYWTGDLAEMDEEGYFRILGRTE
EVIKVGEARIGPAEVEAVLLTHPQVAEAAAVGVPGETGEEIAVFVVPQAREFPEELKPLL
AEKLKAHILRHLGPVPPPRVFFRERLPRTRSGKILRRLLKAELLGLDPGDTSGLEEDYGA
GKAP
NT seq 2535 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgcaagcgagggctttccaccgtgcagcaggccctgcgccttctggcctacctg
gccgaccacccggaaggggtgggggcgaaggaggtggcccgcctcctggggaagagcctc
tcctccgcctacgccctcctccacagcctgatggaggagggcttcgtggtgaaggaggag
gggggcttccggctcgcgcggcaaaagcccgtccccttggagcccacgcccttggaggag
gccttggaggagctctacctgcgcacccgggagcggtgctacctcgccctcctcaccccc
cagggggtgcggctcaagacccgggggcggcagggccagctccaccccctgggggagacc
ctgcccccggagtggcacgccctggccctgggaaaggtgctcctcgccttcggggacttc
cccctgccccccctcactcccaagaccccctacaccctcaccgaccccctggccctggag
gaggagctgaagcgcgtccgggcctcggggcttgcggtggagatggaggagtacgccctc
ggggtctccggggtggccgtccccctcttaagcccggaggggcgcctcctcggggccctg
ggggtcaaggtgccctcgcgccgcttccccttcgcctttggccgcctggcccgggccctg
gccgaggtggcccgggtctccgcccaggtcctgcccgaggaagaggcccccacccccccg
cccgccctccccgagccggtaagggtggagcggatagacccccccgaggccctccgccgc
gccgccaacctgcccgacccccgggccgcccaccgggcgagcctcgaggaccccgaggcc
ttctgggaaggcttcgcccggggtttcgcctgggaaaggccctggaaggcggtcttccgc
cgggaggaccggacctggttcgcgggcggcctcaccaacgtggccctaaacgccctggac
cggcacctcccggaaaaggcccagcaggtcgccctcctcaccctggacggagaagggcgg
ctcggcaagtggacctacaaggaggtccgggagctctcaagcaggctcgccgggctcttc
cggaccctcggggtggggcggggggacagggtggccctctacctgcccacgggcctcgag
gccgccctcgccgccttggcctgcgcccggatcggggcggtgcacgcggccctgcccctg
ggcctgggcccggaggccctgaggcggcgcctcgaggacctgaggccccggctcctcgtg
gcggcggacgcctacttctaccggggccagcccgtgcgggtgcgggaggtggtggaggcc
gcaatccagggcctggacctcaaggtcctctggcacgtccggggaagccccgagtttctg
gagcggctttacgaggcccggcccgccgagcccgagcccgtgcccgcggcccaccccctc
ttcctccttcccacctcgggctccacggggaagcccaagggcgtggtccacggccacggg
gggtacatggtgggggtcgcctgggccctccgacacgtctttgacctgaagccgggagag
gtgttccacaccaccgccgacctcttctggatcgtgggccactccttcggcctctacgcc
cccttgctcctcggcggcacctccctcctcgtggaggaccggcccgaccacccgagcccc
ggggccttctacgagcgcctggcccacctcggggtggacgtcctcctcacctcccccgcg
gtgctccggaccctgaggcgccacggggaggcccggcccacgggcctccgcctggcggcg
agcgtgggcgaggtgctgagccccgagatctggcgctggacccgggagcacctggcctgg
cccgtggacaactggtggcagacggagctcggggcccccgccctgccacgcccccccctc
ccggccaagcccggccacgtgggcctccccctccccggggtggaggcccgggtggtggac
gaggaggggcggcccctccctcccgggagcaaggggcacctggtcctcggcgccacgggg
cccgcccacatggtggacctccagggggggcgctccccctggcggggaggcctctactgg
acgggggacctcgcggagatggacgaggaagggtacttccgcatcctgggccgcaccgag
gaggtcatcaaggtgggcgaggcccggatcggccccgcggaggtggaggccgtcctcctc
acccacccccaggtggcggaggcggccgcggtgggggtgccgggggagacgggggaggag
atcgccgtcttcgtggtgccgcaggcccgggagttccccgaggagctcaagcccctcctg
gcggaaaagctcaaggcccacatcctgcggcacctgggccccgtcccgccgcccagggtc
ttcttccgggaacgccttccccggacccgctcggggaagatcctgaggcggctcctcaag
gcggagcttctcggcctagacccgggggacacctcgggactggaggaggactatggcgct
ggaaaagctccttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system