KEGG   Thermus thermophilus HB8: TTHA1250Help
Entry
TTHA1250          CDS       T00220                                 

Definition
acetyl-coenzyme A synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
ttj  Thermus thermophilus HB8
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:ttj01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ttj00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:ttj00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:ttj00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:ttj00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1186235..1188118
Genome map
AA seq 627 aa AA seqDB search
MALEKLLKVQERLWAPEDLRKKANLQDYAAEYRKSLEDPEGFWGAWARRFHWEKPFEKVL
EWTLPEHRWFLGGTTNAVYNALERNVERGLRNKVALLYLAEDGREEKLTYGELLDRVRRL
ATGLRRLGVGKGDRVVIYMPLTLEGVLAMLATAYIGAIHSVVYAGLGVSALRERILDAQA
KLLIAGDVSFRRGKGVDLRSIAEEAIRDLPLKVVWFQRAYKAELAEGHYDFHELLWGNPP
EARAEMVDAEHPLFILYTSGSTGKPKGVVHVHGGYMVGTTYHLRTFFDVKDEDVFWATSD
IGWIVGHSYIVYAPLLEGITSVLREGAPDHPDPGALWQAVERYRVNVMFTAPTAVRMFMK
YGPEWPRKYDLSSLRLLAVAGEPLNPEALKWAYEHLVDGGRRGFVADNWWQTELGGPTLG
TPLVLPAKPGFAGVALPGVEAEVVDEEGRPVPPGQGGLLVLKRPFPHMMRTVWGNHERYL
RYWQEVPGGVYASGDVASKDEEGYFSVLGRADDVLNVAGHRIGTADVESALVSHPAVAEA
AVIGVPDPLKGEAIKAFVVLRLGQTPSEELKEALVQHVRRELGPIATPSEVVFLDKLPKT
RSGKILRRLLKAQALGKDPGDLSTLEE
NT seq 1884 nt NT seq  +upstreamnt  +downstreamnt
atggcgctggaaaagctccttaaggttcaggaaaggctttgggcaccggaggacttgcgg
aagaaggcgaacctccaggactacgcggcggagtaccggaaaagcctcgaggaccctgag
ggcttctggggggcttgggcgcggcgcttccactgggaaaagccctttgagaaggtcctt
gagtggaccctcccggagcaccgctggttcctgggcggcaccaccaacgccgtctacaac
gccctggagcggaacgtggaaaggggcctaaggaacaaggtggccctcctctacctcgcc
gaggacggccgggaggaaaagctcacctacggggagcttctggaccgggtgcgccgcctg
gccacggggcttaggcgcctcggggtgggaaagggggaccgggtggtgatctacatgccc
ctcaccctggaaggggtcctcgccatgctcgccaccgcctacatcggcgccatccacagc
gtggtctacgccgggcttggggtctcggccctgagggagcgcatcctggacgcccaggcc
aagctcctcatcgccggggacgtaagcttccggcggggaaaaggggtggacctcaggagc
atcgccgaggaggccatccgggaccttcccctaaaagtggtctggttccagcgggcgtac
aaggcggagcttgccgaagggcactacgacttccacgagctcctctggggtaaccccccc
gaggcccgggcggagatggtggacgccgagcaccccctcttcatcctctacacctcgggc
tccacgggaaagcccaagggcgtggtccacgtccacggggggtacatggtgggcaccacc
taccacctgcgcaccttctttgacgtgaaggacgaggacgtcttctgggccacgagcgac
atcggctggatcgtgggccactcctacatcgtctacgcccctcttcttgaggggatcacc
tccgtcctccgggaaggggcccccgaccaccccgaccccggggccctctggcaggcggtg
gagcggtaccgggtgaacgtgatgttcaccgcccccacggcggtgcgcatgttcatgaag
tacggccccgagtggcccaggaagtacgacctcagctccttgcgccttctggccgtggcc
ggagagcccttgaaccccgaggccctgaagtgggcctacgagcacctggtggacgggggc
aggcggggcttcgtggcggacaactggtggcagacggagctcggcggccccaccctggga
acccccctcgtcctccccgccaagcccggcttcgccggggtggccctccccggggtggag
gcggaggtggtggacgaggagggcaggcccgtccccccggggcagggcggcctcctcgtc
ctcaagcggcccttcccccacatgatgcgcaccgtctgggggaaccacgagcgctacctc
cggtactggcaggaggtcccggggggcgtctacgccagcggggacgtggcgagcaaggac
gaggaggggtacttcagcgtcttgggccgggcggacgacgtgctgaacgtcgcggggcac
cgcatcggtaccgccgacgtggaaagcgccctggtctcccaccccgccgtggccgaggcc
gcggtcatcggcgtccccgaccccctgaagggggaggccatcaaggccttcgtggtcctt
aggcttgggcaaaccccctcggaggagctgaaggaggccctcgtccagcacgtgcgccgg
gagctcgggcccatcgccacgccgagcgaggtggtcttcctggacaagctccccaagacc
cgctcggggaagatcctgaggcggctcctcaaggcccaggccctgggcaaggaccccggg
gacctctccaccctcgaggagtag

DBGET integrated database retrieval system