KEGG   Thermus thermophilus HB8: TTHA1261Help
Entry
TTHA1261          CDS       T00220                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
ttj  Thermus thermophilus HB8
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ttj00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    TTHA1261
Enzymes [BR:ttj01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     TTHA1261
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(1201574..1203076)
Genome map
AA seq 500 aa AA seqDB search
MELPRAFGLLLHPTSLPGPYGVGVLGQEARDFLRFLKEAGGRYWQVLPLGPTGYGDSPYQ
SFSAFAGNPYLIDLRPLAERGYVRLEDPGFPQGRVDYGLLYAWKWPALKEAFRGFKEKAS
PEEREAFAAFREREAWWLEDYALFMALKGAHGGLPWNRWPLPLRKREEKALREAKSALAE
EVAFHAFTQWLFFRQWGALKAEAEALGIRIIGDMPIFVAEDSAEVWAHPEWFHLDEEGRP
TVVAGVPPDYFSETGQRWGNPLYRWDVLEREGFSFWIRRLEKALELFHLVRIDHFRGFEA
YWEIPASCPTAVEGRWVKAPGEKLFQKIQEVFGEVPVLAEDLGVITPEVEALRDRFGLPG
MKVLQFAFDDGMENPFLPHNYPAHGRVVVYTGTHDNDTTLGWYRTATPHEKAFMARYLAD
WGITFREEEEVPWALMHLGMKSVARLAVYPVQDVLALGSEARMNYPGRPSGNWAWRLLPG
ELSPEHGARLRAMAEATERL
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggagcttccccgcgctttcggtctgcttctccaccccacgagcctccccggcccctac
ggcgtcggcgtcctgggccaggaggcccgggacttcctccgcttcctcaaggaggcaggg
gggcggtactggcaggtcctccccttgggccccacgggctatggcgactccccctaccag
tccttcagcgccttcgccggaaacccctacctcatagacctgaggcccctcgcggaaagg
ggctacgtgcgcctggaggaccccggcttcccccaaggccgggtggactacggcctcctc
tacgcctggaagtggcccgccctgaaggaggccttccggggcttcaaggaaaaggcctcc
ccggaggagcgggaggccttcgccgccttccgggagagggaggcctggtggctcgaggac
tacgccctcttcatggccctgaagggggcgcacggggggcttccctggaaccggtggccc
cttcccctgcggaagcgggaagagaaggcccttagggaggcgaaaagcgccttggccgag
gaggtggccttccacgccttcacccagtggctcttcttccgccagtggggggccttgaag
gcggaggccgaggcgttgggcatccggatcatcggggacatgcccatcttcgtggccgag
gactccgccgaggtctgggcccaccccgagtggtttcacctggacgaggagggccgcccc
acggtggtggcgggggtgccccccgactacttctcggagacgggccagcgctggggcaac
cccctttaccgctgggacgttttggagcgggaggggttctccttctggatccgccgtctg
gagaaggccctggagctcttccacctggtgcgcatagaccacttccgcggctttgaggcc
tactgggagatccccgcaagctgccccacggcggtggaggggcgctgggtcaaggccccg
ggggagaagctcttccagaagatccaggaggtcttcggcgaggtccccgtcctcgccgag
gacctgggggtcatcacccccgaggtggaggccctgcgcgaccgcttcggccttcccggg
atgaaggtcctgcagttcgcctttgacgacgggatggaaaaccccttcctcccccacaac
taccctgcccacggccgggtggtggtctacaccggcacccacgacaacgacaccaccctg
ggctggtaccgcacggccaccccccacgagaaggccttcatggcgcggtacctggcggac
tgggggatcaccttccgggaagaggaggaggtgccctgggccctgatgcacctggggatg
aagtccgtggcccggctcgccgtctacccggtgcaggacgtcctggccctgggcagcgag
gcccggatgaactacccgggaaggccctcggggaactgggcctggcggctcctcccgggg
gagctttccccggagcacggggcgaggcttagggccatggccgaggccacggaacggctc
tag

DBGET integrated database retrieval system