KEGG   Thermus thermophilus HB8: TTHA1462Help
Entry
TTHA1462          CDS       T00220                                 

Definition
(RefSeq) phosphoribosyltransferase
Organism
ttj  Thermus thermophilus HB8
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(1388445..1389071)
Genome map
AA seq 208 aa AA seqDB search
MRFRDRRHAGALLAEALAPLGLEAPVVLGLPRGGVVVADEVARRLGGELDVVLVRKVGAP
GNPEFALGAVGEGGELVLMPYALRYADQSYLEREAARQRDVLRKRAERYRRVRPKAARKG
RDVVLVDDGVATGASMEAALSVVFQEGPRRVVVAVPVASPEAVERLKARAEVVALSVPQD
FAAVGAYYLDFGEVTDEDVEAILLEWAG
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgcgctttcgcgaccgcaggcacgccggggcgctcctcgccgaggccttggcccccttg
ggcctcgaggcgcccgtggtcctgggcctgccccggggcggggtggtggtggccgacgag
gtggcgaggcgcctgggcggggagctggacgtggtcctggtgcgcaaggtgggcgccccg
ggaaacccggagttcgccctgggggccgtgggggagggaggggagctcgtcctcatgccc
tacgccctgcggtacgccgaccaaagctacctggagcgggaggcggcccggcaacgggac
gtcctccgtaagcgggcggagcgttaccggagggtgcggcccaaggcggcccgcaagggt
cgggacgtggtgctggtggacgacggggtggccacgggggcgagcatggaggcggccctc
tccgtggtcttccaggaggggccgaggcgcgtggtggtggccgtgcccgtggcgagcccg
gaggcggtggagcggcttaaggcccgggcggaggtggtggccctttccgtcccccaggac
ttcgccgccgtgggggcctactacctggacttcggcgaggtgaccgacgaggacgtggag
gccatcctgctagaatgggcgggatga

DBGET integrated database retrieval system