KEGG   Thermus thermophilus HB8: TTHA1496Help
Entry
TTHA1496          CDS       T00220                                 

Definition
arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
ttj  Thermus thermophilus HB8
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ttj00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TTHA1496
  Amino acid metabolism
   00330 Arginine and proline metabolism
    TTHA1496
Enzymes [BR:ttj01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     TTHA1496
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(1423629..1424504)
Genome map
AA seq 291 aa AA seqDB search
MERVAVVGVPMDLGANRRGVDMGPSALRYARLLEQLEDLGYTVEDLGDVPVSLARASRRR
GRGLAYLEEIRAAALVLKERLAALPEGVFPIVLGGDHSLSMGSVAGAARGRRVGVVWVDA
HADFNTPETSPSGNVHGMPLAVLSGLGHPRLTEVFRAVDPKDVVLVGVRSLDPGEKRLLK
EAGVRVYTMHEVDRLGVARIAEEVLKHLQGLPLHVSLDADVLDPTLAPGVGTPVPGGLTY
REAHLLMEILAESGRVQSLDLVEVNPILDERNRTAEMLVGLALSLLGKRIF
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atggaacgcgtggccgtggtgggcgtgcccatggacctgggggcgaaccggcggggcgtg
gacatggggccgtccgccctgcggtacgcccggcttctggagcagctggaggatctgggc
tacaccgtggaggacctgggggacgtacccgtctccctggcccgggcctcgaggcgaagg
gggcggggcctcgcctacctggaggagatccgggccgcggccctcgtcctaaaggagcgc
cttgcggccctgcccgagggggttttccccatcgtcttgggcggggaccactccttgagc
atgggctccgtggcgggggccgcccggggccggcgggtgggcgtggtctgggtggacgcc
cacgccgacttcaacacccccgagacctcgccgagcggcaacgtccacggcatgcccctc
gccgtcctctcgggcctgggccatccccggctcacggaggtcttccgggccgtggacccc
aaggacgtggtcctggtgggggtgcggagcctggatcccggggagaagcgcctccttaag
gaggcgggggtccgggtctacaccatgcacgaggtggaccgcctcggcgtggcccggatc
gccgaggaggttctaaagcacctccagggcctccccctccacgtctccctggacgccgac
gtcctggaccccaccctcgcccccggggtggggaccccggtgcccggggggctcacctac
cgggaggcccacctcctcatggagatcctggccgagtcgggccgggtgcagagcctggac
ctggtggaggtgaaccccatcctggacgagcgcaaccgcaccgccgagatgctggtgggc
ctggcgctaagcctcttgggcaagcggatcttttag

DBGET integrated database retrieval system