KEGG   Thermus thermophilus HB8: TTHA1705Help
Entry
TTHA1705          CDS       T00220                                 

Definition
esterase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
ttj  Thermus thermophilus HB8
Brite
Enzymes [BR:ttj01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     TTHA1705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1600307..1600990
Genome map
AA seq 227 aa AA seqDB search
MHLLLLHGFTSHPVLTLGPLSERLKEAGWEVRQPALPGHGTRPEDLLKVRFQDWLLAAEE
AYLELPEPRGVVGLSMGGLLAAHLAARHPTKALVALAPAFALKNPLAPYLHWLIPRFPGP
PSIEDPELRKRNPNYPYFPTRAVLELLALMRKTPEVLPRVKARALVVEAGKDRVVKGVDR
YFALLGSPRKDHLVFPESGHDLLLDRDREEVARAVRDWLLASDNYLQ
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgcaccttctcctcctccacggcttcacttcccaccccgtcctcaccctcggccccctg
tcggaaaggcttaaggaggcggggtgggaggtgcgccagcccgccctgccgggccacggc
acgcggcccgaggacctcctaaaggtgcgctttcaggactggctcctggcggcggaggag
gcctacctggagcttcccgagccccggggggtggtggggctttccatgggggggcttctc
gccgcccacctcgccgcccgccaccccacaaaggccctcgtggccctggcccccgccttc
gccctgaaaaaccccttggcgccctacctccactggctcatcccccgctttcccggcccg
ccctccatagaggacccggagctcaggaagcgcaaccccaactacccctacttccccacc
cgggccgtcctggagctcctcgccctcatgcgcaagaccccggaggtcctcccccgggtg
aaggcccgggccctggtggtggaggcggggaaagaccgggtggtgaagggggtggaccgg
tacttcgccctcttgggaagcccgaggaaggaccacctcgtcttcccggaaagcggccac
gacctcctcctggaccgggaccgggaggaggtggcccgggcggtgcgcgactggcttctt
gcaagtgataactacttgcaataa

DBGET integrated database retrieval system