KEGG   Thermus thermophilus HB8: TTHA1771Help
Entry
TTHA1771          CDS       T00220                                 

Definition
pyrimidine-nucleoside (thymidine) phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
ttj  Thermus thermophilus HB8
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ttj00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    TTHA1771
Enzymes [BR:ttj01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     TTHA1771
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(1659112..1660383)
Genome map
AA seq 423 aa AA seqDB search
MNPVAFIREKREGKKHRREDLEAFLLGYLRDEVPDYQVSAWLMAAFLRGLDPEETLWLTE
TMARSGKVLDLSGLPHPVDKHSSGGVGDKVSLVVGPILAASGCTFAKMSGRGLAHTGGTI
DKLESVPGWRGEMTEAEFLERARRVGLVIAAQSPDLAPLDGKLYALRDVTATVESVPLIA
SSIMSKKLAAGARSIVLDVKVGRGAFMKTLEEARLLAKTMVAIGQGAGRRVRALLTSMEA
PLGRAVGNAIEVREAIEALKGEGPGDLLEVALALAEEALRLEGLDPALARKALEGGAALE
KFRAFLEAQGGDPRAVEDFSLLPLAEEHPLRAEREGVVREVDAYKVGLAVLALGGGRKRK
GEPIDHGVGVYLLKKPGDRVERGEALALVYHRRRGLEEALGHLREAYALGEEAHPAPLVL
EAI
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgaaccccgtggccttcatccgggagaagcgggaagggaaaaagcaccgccgggaggac
ctcgaggccttcctcctcggctacctgcgggacgaggttccggactaccaggtttccgcc
tggctcatggcggcctttctgcgggggctggaccccgaggagaccctctggctcaccgag
accatggcccgctcggggaaggttctggacctttccggccttccccaccccgtggacaag
cactcctcggggggcgtgggggacaaggtgagcctggtggtggggccgatcctcgccgca
agcgggtgcaccttcgccaagatgtcgggccggggcctggcccacaccgggggaaccata
gacaagctggagtcggtgccgggctggcgaggggagatgacggaggcggagtttttggag
agggcgcggagggtgggcctcgtcatcgccgcccaaagcccggacctcgcccccctggac
gggaagctctacgccctccgcgacgtgaccgccacggtggagagcgtgcccttgatcgcg
agctccatcatgagcaagaagctcgccgccggggcgcggagcattgtcttggacgtgaag
gtgggccggggggccttcatgaagaccctggaggaggcccggcttttggccaagaccatg
gtggccatcggccagggggcgggaaggcgggtgagggccctcctcacctccatggaggcc
cccctggggcgggcggtggggaacgccatagaggtgcgggaggccatagaggccctcaaa
ggggagggccccggggaccttctggaggtggccctggccctggcggaggaggccttaagg
cttgaggggctggaccccgccctcgcccggaaggccctggagggcggggcggccttggag
aagttccgggccttcctcgaggcccaggggggggacccccgggcggtggaggacttctcc
cttttgcccctcgccgaggagcaccccctccgtgccgagcgggagggcgtggtgcgggag
gtggacgcctacaaggtgggcctcgccgtcctcgccctgggcggggggcggaagcggaag
ggggagcccattgaccacggggtgggggtctacctgctcaagaagcccggggaccgggtg
gagcggggggaggccttggccttggtctaccaccggaggcggggcctggaggaggccctt
gggcacctgcgcgaggcctacgccctaggggaggaggcgcaccccgcccccttggtcctg
gaggccatctag

DBGET integrated database retrieval system