KEGG   Thermus thermophilus HB8: TTHA1811Help
Entry
TTHA1811          CDS       T00220                                 

Definition
fuculose-1-phosphate aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
ttj  Thermus thermophilus HB8
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ttj00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    TTHA1811
Enzymes [BR:ttj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     TTHA1811
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(1688989..1689591)
Genome map
AA seq 200 aa AA seqDB search
MRARLYAAFRQVGEDLFAQGLISATAGNFSVRTKGGFLITKSGVQKARLTPEDLLEVPLE
GPIPEGASVESVVHREVYRRTGARALVHAHPRVAVALSFHLSRLRPLDLEGQHYLKEVPV
LAPKTVSATEEAALSVAEALREHRACLLRGHGAFAVGLKEAPEEALLEAYGLMTTLEESA
QILLYHRLWQGAGPALGGGE
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcgcccggttgtacgccgcgttccgtcaggtgggcgaggacctcttcgcccagggc
ctcatctccgccacggccgggaacttctccgtgcgcaccaagggggggttcctcatcacc
aaaagcggggtgcagaaggcgaggctcaccccggaggacctcctggaggtgcccttggaa
gggcccatccccgaaggggcgagcgtggagagcgtggtccaccgggaggtctaccgcagg
accggggcccgggccctggtccacgcccacccccgggtggccgtggccctctccttccac
ctctcccgcctaaggcctttggacctcgagggccagcactacctgaaggaggtcccggtc
ctcgcccccaagacggtctccgccacggaggaggcggccttgagcgtggccgaggccttg
cgggagcaccgggcctgcctcctgagggggcacggggccttcgccgtgggcctgaaggag
gccccggaggaggcccttctcgaggcctacggcctcatgaccaccctggaggagagcgcc
cagatcctcctctaccaccgcctctggcagggggcggggcccgccttggggggtggggaa
tga

DBGET integrated database retrieval system