KEGG   Thermus thermophilus HB8: TTHA1878Help
Entry
TTHA1878          CDS       T00220                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
ttj  Thermus thermophilus HB8
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ttj00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(1764078..1764740)
Genome map
AA seq 220 aa AA seqDB search
MSPGPQSGGQERGSMERKMVELEDTGLTFATEVDLERLQALAAEWLQVIGEDPGREGLLK
TPERVAKAWAFLTRGYRQRLEEVVGGAVFPAEGSEMVVVKGVEFYSMCEHHLLPFFGKVH
IGYIPDGKILGLSKFARIVDMFARRLQVQERLAVQIAEAIQEVLEPQGVGVVVEGVHLCM
MMRGVEKQHSRTVTSAMLGVFRENQKTREEFLSHLRDGTA
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
gtgagcccggggccacagagcggggggcaagaaaggggcagcatggagcgcaagatggtg
gagcttgaggacacgggcttgaccttcgcgaccgaggtggacctggagcgcctccaggcc
ctcgccgccgagtggctccaggtcatcggggaagaccccggccgcgaggggcttttgaag
acgccggagcgggtggccaaggcctgggccttcctcacccggggctaccggcagcgcctg
gaggaggtggtgggcggcgccgttttcccggcggaggggagcgagatggtggtggtgaag
ggcgtggagttctactccatgtgcgagcaccacctccttcccttcttcggcaaggtccac
atcggctacatccccgacgggaagatcctgggcctctccaagttcgcccgcatcgtggac
atgttcgcccgcaggctccaggtgcaggagcgcctcgcggtccagatcgccgaggccatc
caggaggttctggagccccagggggtgggggtggtggtggaaggggtccacctctgcatg
atgatgcggggggtggagaagcagcactcccgcaccgtgacgagcgccatgctgggggtc
ttccgggagaaccagaagacccgggaggagtttttgagccacctcagggacgggacggcc
taa

DBGET integrated database retrieval system