KEGG   Thermus thermophilus HB8: TTHA1896Help
Entry
TTHA1896          CDS       T00220                                 

Definition
glucosamine--fructose-6-phosphate aminotransferase
Orthology
K00820  
glucosamine--fructose-6-phosphate aminotransferase (isomerizing) [EC:2.6.1.16]
Organism
ttj  Thermus thermophilus HB8
Pathway
Alanine, aspartate and glutamate metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ttj00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    TTHA1896
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    TTHA1896
Enzymes [BR:ttj01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.16  glutamine---fructose-6-phosphate transaminase (isomerizing)
     TTHA1896
Peptidases [BR:ttj01002]
 Cysteine Peptidases
  Family C44
   TTHA1896
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1781934..1783748
Genome map
AA seq 604 aa AA seqDB search
MCGIVGYVGFRNATDVLLDGLRRLEYRGYDSAGIAVRTPEGLKVVKRSGKLSALAEAVGK
TPLQGALGIGHTRWATHGAPTDPNAHPHTTEDGRIALIHNGIFENYLELKEALEARGHRF
RSETDTEVLAHLLEETYRGDLLEALREALKAVRGAYAVVVAHEDHEEIVAARTVSPLVVG
LGEGENFLASDVPALLPYTRRVLFLHDGDVVRLTREGVEITDLEGRPVQREAVEVDWTLE
AAEKGGFPHYMLKEIYEQPWVLENTLGGRLREEEGTVELGLALDPREVDRVHVIACGTAS
YAGLYGKYLLETLARLPTEWDVASEYRYRDPVVDSRTLALAISQSGETIDTLEGLREAKR
KGARSLGVINAKGSTLTREVEDVLYIHAGPEIGVASTKAYTAMLAAMALLAVWFGRGRGA
LALEEAQRLLREMRRLPRLVEEVLEKRPLVAHVAEKYHQARDFLFLGRHVQAPTAYEGAL
KLKEISYIHAEAYPAGEMKHGPIALIDEHLPVVVLATKGPLYEKTLSNIQEVRARGGKVI
AIATEGDEEIPRLAQDVIYVPEVHPLLAPIVSVVPLQLLAYEIAVLLGRDVDQPRNLAKS
VTVE
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgtgcgggatcgtaggctacgtaggttttaggaacgcgacggacgtgcttttggacggg
ctccggcgcctggagtatagggggtacgactccgccggcattgcggtgcggaccccggag
ggcctcaaggtggtgaagcgctcggggaagctctccgccctggcagaggccgtggggaag
acgcccctccagggggccttgggcatcggccacacccgctgggccacccacggggccccc
acggacccgaacgcccacccccacaccacggaggacgggaggatcgccctcatccacaac
ggcatctttgagaactacctggagctcaaggaggccctggaggcccgggggcaccgcttc
cggtcggagacggacaccgaggtcctcgcccacctcctggaggaaacctaccgaggcgac
ctccttgaggccctgcgggaggccctcaaggcggtgcgcggggcctacgccgtggtggtg
gcccacgaggaccacgaggagatcgtggccgcccgcacggtgagccccctggtggtgggc
ctgggggagggggagaacttcctggcctcggacgtgcccgccctcctcccctacacccgc
cgggtcctcttcctgcacgacggggacgtggtgcgcctcacccgggagggggtggagatc
accgacctggagggcaggccggtccagagggaggcggtggaggtggactggaccctggag
gccgccgagaaggggggcttcccccactacatgctgaaggagatctacgagcaaccctgg
gtcctggagaacaccctgggcgggcgcctgagggaggaggaggggaccgtggagctcggc
ctcgccctggacccacgggaggtggaccgggtccacgtcatcgcctgcggaacggcgagc
tacgccgggctttacgggaagtacctcctggagaccctggcccgcctccccaccgagtgg
gacgtggccagcgagtaccgctaccgcgaccccgtggtggactcgaggaccctcgccctc
gccatcagccagtcgggggagaccatagacaccctggagggcctgagggaggccaagcgc
aagggggcccgctccctcggggtcatcaacgccaaggggagcaccctgacgcgggaggtg
gaggacgtcctctacatccacgccgggccggagatcggggtggcctccaccaaggcctac
acggccatgctcgcggccatggccctcctcgccgtctggttcggccggggccggggcgcc
ctcgccctcgaggaggcccaacgcctcctccgggagatgcgccgcctccccaggctcgtg
gaggaggtcttggagaaaaggcccctcgtggcccacgtggccgagaagtaccaccaggcc
cgggacttcctcttcctggggcggcacgtccaggcccccaccgcctacgagggggcgctg
aagctcaaggagatcagctacatccacgccgaggcctaccccgccggggagatgaagcac
gggcccatcgccctcattgacgagcacctccccgtggtcgtcctcgccaccaaaggcccc
ctctacgagaagaccctctccaacatccaggaggtgcgggcccggggcgggaaggtgatc
gccatcgccaccgagggggacgaggagatcccgaggctcgcccaggacgtgatctacgtc
cccgaggtccaccccctcctcgcccccatcgtgagcgtggtccccctccagctcctcgcc
tacgagatcgccgtgctcctggggcgggacgtggaccagccccgcaacctggccaagagc
gtgaccgtggagtga

DBGET integrated database retrieval system