KEGG   Thermus thermophilus HB8: TTHA1896Help
Entry
TTHA1896          CDS       T00220                                 

Definition
(RefSeq) glucosamine--fructose-6-phosphate aminotransferase
  KO
K00820  
glucosamine--fructose-6-phosphate aminotransferase (isomerizing) [EC:2.6.1.16]
Organism
ttj  Thermus thermophilus HB8
Pathway
Alanine, aspartate and glutamate metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ttj00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    TTHA1896
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    TTHA1896
 Human Diseases
  Endocrine and metabolic diseases
   04931 Insulin resistance
    TTHA1896
Enzymes [BR:ttj01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.16  glutamine---fructose-6-phosphate transaminase (isomerizing)
     TTHA1896
Peptidases [BR:ttj01002]
 Cysteine Peptidases
  Family C44
   TTHA1896
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1781934..1783748
Genome map
AA seq 604 aa AA seqDB search
MCGIVGYVGFRNATDVLLDGLRRLEYRGYDSAGIAVRTPEGLKVVKRSGKLSALAEAVGK
TPLQGALGIGHTRWATHGAPTDPNAHPHTTEDGRIALIHNGIFENYLELKEALEARGHRF
RSETDTEVLAHLLEETYRGDLLEALREALKAVRGAYAVVVAHEDHEEIVAARTVSPLVVG
LGEGENFLASDVPALLPYTRRVLFLHDGDVVRLTREGVEITDLEGRPVQREAVEVDWTLE
AAEKGGFPHYMLKEIYEQPWVLENTLGGRLREEEGTVELGLALDPREVDRVHVIACGTAS
YAGLYGKYLLETLARLPTEWDVASEYRYRDPVVDSRTLALAISQSGETIDTLEGLREAKR
KGARSLGVINAKGSTLTREVEDVLYIHAGPEIGVASTKAYTAMLAAMALLAVWFGRGRGA
LALEEAQRLLREMRRLPRLVEEVLEKRPLVAHVAEKYHQARDFLFLGRHVQAPTAYEGAL
KLKEISYIHAEAYPAGEMKHGPIALIDEHLPVVVLATKGPLYEKTLSNIQEVRARGGKVI
AIATEGDEEIPRLAQDVIYVPEVHPLLAPIVSVVPLQLLAYEIAVLLGRDVDQPRNLAKS
VTVE
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgtgcgggatcgtaggctacgtaggttttaggaacgcgacggacgtgcttttggacggg
ctccggcgcctggagtatagggggtacgactccgccggcattgcggtgcggaccccggag
ggcctcaaggtggtgaagcgctcggggaagctctccgccctggcagaggccgtggggaag
acgcccctccagggggccttgggcatcggccacacccgctgggccacccacggggccccc
acggacccgaacgcccacccccacaccacggaggacgggaggatcgccctcatccacaac
ggcatctttgagaactacctggagctcaaggaggccctggaggcccgggggcaccgcttc
cggtcggagacggacaccgaggtcctcgcccacctcctggaggaaacctaccgaggcgac
ctccttgaggccctgcgggaggccctcaaggcggtgcgcggggcctacgccgtggtggtg
gcccacgaggaccacgaggagatcgtggccgcccgcacggtgagccccctggtggtgggc
ctgggggagggggagaacttcctggcctcggacgtgcccgccctcctcccctacacccgc
cgggtcctcttcctgcacgacggggacgtggtgcgcctcacccgggagggggtggagatc
accgacctggagggcaggccggtccagagggaggcggtggaggtggactggaccctggag
gccgccgagaaggggggcttcccccactacatgctgaaggagatctacgagcaaccctgg
gtcctggagaacaccctgggcgggcgcctgagggaggaggaggggaccgtggagctcggc
ctcgccctggacccacgggaggtggaccgggtccacgtcatcgcctgcggaacggcgagc
tacgccgggctttacgggaagtacctcctggagaccctggcccgcctccccaccgagtgg
gacgtggccagcgagtaccgctaccgcgaccccgtggtggactcgaggaccctcgccctc
gccatcagccagtcgggggagaccatagacaccctggagggcctgagggaggccaagcgc
aagggggcccgctccctcggggtcatcaacgccaaggggagcaccctgacgcgggaggtg
gaggacgtcctctacatccacgccgggccggagatcggggtggcctccaccaaggcctac
acggccatgctcgcggccatggccctcctcgccgtctggttcggccggggccggggcgcc
ctcgccctcgaggaggcccaacgcctcctccgggagatgcgccgcctccccaggctcgtg
gaggaggtcttggagaaaaggcccctcgtggcccacgtggccgagaagtaccaccaggcc
cgggacttcctcttcctggggcggcacgtccaggcccccaccgcctacgagggggcgctg
aagctcaaggagatcagctacatccacgccgaggcctaccccgccggggagatgaagcac
gggcccatcgccctcattgacgagcacctccccgtggtcgtcctcgccaccaaaggcccc
ctctacgagaagaccctctccaacatccaggaggtgcgggcccggggcgggaaggtgatc
gccatcgccaccgagggggacgaggagatcccgaggctcgcccaggacgtgatctacgtc
cccgaggtccaccccctcctcgcccccatcgtgagcgtggtccccctccagctcctcgcc
tacgagatcgccgtgctcctggggcgggacgtggaccagccccgcaacctggccaagagc
gtgaccgtggagtga

DBGET integrated database retrieval system