KEGG   Thermus thermophilus HB8: TTHA1927Help
Entry
TTHA1927          CDS       T00220                                 

Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
ttj  Thermus thermophilus HB8
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:ttj00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TTHA1927
  Amino acid metabolism
   00330 Arginine and proline metabolism
    TTHA1927
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    TTHA1927
Enzymes [BR:ttj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     TTHA1927
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1807406..1808518
Genome map
AA seq 370 aa AA seqDB search
MRPGLSAKRLVVKVGSAVLTGERGLDLEAMAEIARQVAALREEGREVVLVSSGAVAAGMR
RLGLKERPKDMPKKQALAALGQPLLMAFWQEAFAPFGLPVAQVLLTAEDLSSRSRYLNAK
ATLRALLDLGAIPVINENDTVAFEEIRFGDNDQLSARVAALVEAGLLALLSDVDALYEED
PKKNPQARPIPEVESVEAVLAHAGEENPLGSGGMKSKLLAARIAGRVGIPTLLLPGKRPG
VLLQALSGAPLGTYFHARRRYRGEKAWLFGLLRPKGELVLDRGAVRALKERGASLLPAGV
KEVRGRFSRGEAVRLLSEEGEEVGVGLANYASEEIARIKGRRSAEIEAVLGYRYTEEVVH
RDHLALKEEA
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgcgcccggggctttcggccaagcgcctggtggtcaaggtgggaagcgccgtcctcaca
ggggaaaggggcctggacctcgaggccatggccgagatcgcccgccaggtggccgccctg
agggaggaaggccgggaggtggtcctcgtctcctcgggggcggtggcggcgggaatgcga
cggctcgggctaaaggagcgccccaaggacatgcccaagaagcaggccctcgccgccctc
ggccagcccctcctcatggccttctggcaagaggccttcgcccccttcggccttcccgtg
gcccaggtcctcctcaccgccgaggacctctcctccaggagccgctacctgaacgccaag
gccaccttgcgggccctcctggacctgggggccatacccgtgatcaacgaaaacgacacc
gtggcctttgaggagatccgctttggggacaacgaccagctctccgcccgggtggcggcc
ctggtggaggcgggcctcctcgccctcctctccgatgtggacgccctctacgaggaggac
cccaagaaaaacccccaggcccgccccatccccgaggtggagtccgtggaggcggttttg
gcccacgccggagaggaaaacccgctaggaagcggggggatgaagagcaagctcctcgcc
gcccgcatcgccggtagggtggggatccccaccctgcttctccccgggaagcggccaggg
gtcctcctccaagccctctccggggcccccctgggcacctacttccacgcgcggcggcgc
taccggggggaaaaggcctggctttttggcctcctccgccccaagggggagctcgtcctg
gaccggggggcggtgcgggccttaaaggagcggggagcgagcctgcttcccgccggggtt
aaggaggtgcgggggaggttctcccggggcgaggcggtccgcctcctctcggaggagggc
gaggaggtgggggtggggctcgccaactacgcctcggaggagatcgcccgcatcaagggg
cggcggagcgcggagattgaggccgtcctgggctaccgctacaccgaggaggtggtccac
cgggaccacctcgccttgaaggaggaggcatga

DBGET integrated database retrieval system