KEGG   Thermus thermophilus HB8: TTHA1962Help
Entry
TTHA1962          CDS       T00220                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ttj  Thermus thermophilus HB8
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ttj00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TTHA1962 (pfkA)
   01230 Biosynthesis of amino acids
    TTHA1962 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TTHA1962 (pfkA)
   00030 Pentose phosphate pathway
    TTHA1962 (pfkA)
   00051 Fructose and mannose metabolism
    TTHA1962 (pfkA)
   00052 Galactose metabolism
    TTHA1962 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    TTHA1962 (pfkA)
Enzymes [BR:ttj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     TTHA1962 (pfkA)
Protein phosphatases and associated proteins [BR:ttj01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     TTHA1962 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1838240..1839208)
Genome map
AA seq 322 aa AA seqDB search
MKRIGVFTSGGDAPGMNAAIRAVVRQAHALGVEVIGIRRGYAGMIQGEMVPLGVRDVANI
IQRGGTILLTARSQEFLTEEGRAKAYAKLQAAGIEGLVAIGGDGTFRGALCLVEEHGMPV
VGVPGTIDNDLYGTDYTIGFDTAVNTALEAIDRIRDTAASHERVFFIEVMGRHAGFIALD
VGLAGGAEVIAVPEEPVDPKAVAEVLEASQRRGKKSSIVVVAEGAYPGGAAGLLAAIREH
LQVEARVTVLGHIQRGGSPTAKDRILASRLGAAAVEALVGGASGVMVGEVEGEVDLTPLK
EAVERRKDINRALLRLSQVLAL
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcatcggggtgttcaccagcggcggcgacgcgccggggatgaacgcggccatc
cgggcggtggtgcgccaggcccacgccctgggggtggaggtcatcgggatccgccgcggc
tacgccggcatgatccaaggggagatggtgcccttgggggtgcgggacgtggccaacatc
atccagcggggcgggacgatcctcctcacggcgaggagccaggagttcctcacggaggag
gggcgggccaaggcctacgccaagctgcaggcggcggggattgagggcctggtggccatc
ggcggcgacgggaccttccgcggggcgctttgcctcgtggaggagcacgggatgccggtg
gtgggggttccgggcaccatagacaacgacctctacggcacggactacaccatcggcttt
gacaccgcggtgaacacggccctcgaggccatagaccggatccgggacaccgcggcgagc
cacgagcgggtcttcttcatagaggtcatggggcggcacgccgggttcatcgccctggac
gtggggcttgccggcggggcggaggtcatcgccgtccccgaggagcccgtggaccccaag
gccgtggccgaggtgctggaggcctcccagaggcgggggaagaagagctccatcgtggtg
gtggccgagggggcctaccccggcggggccgcggggcttctcgccgccatccgggagcac
ctccaggtggaggcccgggtcaccgtcctggggcacatccagcggggcgggagccccacg
gccaaggaccggatcctggcgagccgcctgggggcggccgcggtggaggccctggtgggc
ggggcgagcggggtcatggtgggggaggtggagggcgaggtggacctcacccccctgaag
gaggcggtggagcgcaggaaggacatcaaccgggccctcttgcgcctatcgcaggtgctg
gccctctag

DBGET integrated database retrieval system