KEGG   Thermus thermophilus HB8: TTHA1962Help
Entry
TTHA1962          CDS       T00220                                 

Gene name
pfkA
Definition
(RefSeq) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ttj  Thermus thermophilus HB8
Pathway
ttj00010  Glycolysis / Gluconeogenesis
ttj00030  Pentose phosphate pathway
ttj00051  Fructose and mannose metabolism
ttj00052  Galactose metabolism
ttj00680  Methane metabolism
ttj01100  Metabolic pathways
ttj01110  Biosynthesis of secondary metabolites
ttj01120  Microbial metabolism in diverse environments
ttj01130  Biosynthesis of antibiotics
ttj01200  Carbon metabolism
ttj01230  Biosynthesis of amino acids
ttj03018  RNA degradation
Module
ttj_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ttj00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TTHA1962 (pfkA)
   00030 Pentose phosphate pathway
    TTHA1962 (pfkA)
   00051 Fructose and mannose metabolism
    TTHA1962 (pfkA)
   00052 Galactose metabolism
    TTHA1962 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    TTHA1962 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    TTHA1962 (pfkA)
Enzymes [BR:ttj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     TTHA1962 (pfkA)
Protein phosphatases and associated proteins [BR:ttj01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     TTHA1962 (pfkA)
Messenger RNA biogenesis [BR:ttj03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     TTHA1962 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat Peptidase_C13
Motif
Other DBs
NCBI-GeneID: 3169721
NCBI-ProteinID: YP_145228
UniProt: P21777
Position
complement(1838240..1839208)
Genome map
AA seq 322 aa AA seqDB search
MKRIGVFTSGGDAPGMNAAIRAVVRQAHALGVEVIGIRRGYAGMIQGEMVPLGVRDVANI
IQRGGTILLTARSQEFLTEEGRAKAYAKLQAAGIEGLVAIGGDGTFRGALCLVEEHGMPV
VGVPGTIDNDLYGTDYTIGFDTAVNTALEAIDRIRDTAASHERVFFIEVMGRHAGFIALD
VGLAGGAEVIAVPEEPVDPKAVAEVLEASQRRGKKSSIVVVAEGAYPGGAAGLLAAIREH
LQVEARVTVLGHIQRGGSPTAKDRILASRLGAAAVEALVGGASGVMVGEVEGEVDLTPLK
EAVERRKDINRALLRLSQVLAL
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcatcggggtgttcaccagcggcggcgacgcgccggggatgaacgcggccatc
cgggcggtggtgcgccaggcccacgccctgggggtggaggtcatcgggatccgccgcggc
tacgccggcatgatccaaggggagatggtgcccttgggggtgcgggacgtggccaacatc
atccagcggggcgggacgatcctcctcacggcgaggagccaggagttcctcacggaggag
gggcgggccaaggcctacgccaagctgcaggcggcggggattgagggcctggtggccatc
ggcggcgacgggaccttccgcggggcgctttgcctcgtggaggagcacgggatgccggtg
gtgggggttccgggcaccatagacaacgacctctacggcacggactacaccatcggcttt
gacaccgcggtgaacacggccctcgaggccatagaccggatccgggacaccgcggcgagc
cacgagcgggtcttcttcatagaggtcatggggcggcacgccgggttcatcgccctggac
gtggggcttgccggcggggcggaggtcatcgccgtccccgaggagcccgtggaccccaag
gccgtggccgaggtgctggaggcctcccagaggcgggggaagaagagctccatcgtggtg
gtggccgagggggcctaccccggcggggccgcggggcttctcgccgccatccgggagcac
ctccaggtggaggcccgggtcaccgtcctggggcacatccagcggggcgggagccccacg
gccaaggaccggatcctggcgagccgcctgggggcggccgcggtggaggccctggtgggc
ggggcgagcggggtcatggtgggggaggtggagggcgaggtggacctcacccccctgaag
gaggcggtggagcgcaggaaggacatcaaccgggccctcttgcgcctatcgcaggtgctg
gccctctag

DBGET integrated database retrieval system