KEGG   Thermus thermophilus HB8: TTHB032Help
Entry
TTHB032           CDS       T00220                                 

Definition
(RefSeq) putative beta-galactosidase
  KO
K01190  beta-galactosidase [EC:3.2.1.23]
Organism
ttj  Thermus thermophilus HB8
Pathway
ttj00052  Galactose metabolism
ttj00511  Other glycan degradation
ttj00600  Sphingolipid metabolism
ttj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ttj00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    TTHB032
  Lipid metabolism
   00600 Sphingolipid metabolism
    TTHB032
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    TTHB032
Enzymes [BR:ttj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     TTHB032
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_2_C Glyco_hydro_2_N Glyco_hydro_2
Motif
Other DBs
NCBI-GeneID: 3167903
NCBI-ProteinID: YP_145271
UniProt: Q53WD0
Position
pTT27:20794..22518
Genome map
AA seq 574 aa AA seqDB search
MRLDPNHPRPTLQRPGWRSLEGHWDFALSEAEAPGGVRFDRKILVPFPPEAPGSGVGEAW
VGVAWYRKVLRAKPRPGRRLFLRFGAVDYRAEVFVNGVRVLEHEGGHTPFGLDLTPFLER
PVEVLVRAEDDPLDPEAPRGKQALGEPGGIFYPRTTGIWQPVWLEWVPESHIAALRLTPD
LKALGFHLEVQAHGEGEAVEVALFPGVRGEAPLGEAPWLEARFPLLGGRASGFLGLPAKG
NPEGLLWRPETPVLFPLRLRLLSGRRVLDEVYSYGGLREVAAQKGVFLLNGEPYFPRLVL
DQGLWPEGHLAPPSLAALRRDAALAKALGFNGVRKHQKVEDPRYLHLADRLGLLVFAEMP
SFFRFSPKAARRYLAELAEALERDRNHPSLVAWILFNEGWGLTPWRAETLAFLQGAFLLA
RALDPTRLLVDNDGFEHGPFWDLLTVHDYAPPEVLARRYGEGLPEAPMGRPLALAGLPPG
VRPFLSEFGGLRLKGPGPGWGYREAEDEEAFLREALRYLETACGSRLSGFCYTQLYDTFQ
EENGLLDFWRRPKVPPERVRAFLEGCEARRLLAE
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atgcggctggaccccaaccaccccaggcccaccctccagcgccccggctggcggagcctc
gagggccactgggacttcgccctaagcgaggccgaggcgcccggcggggtgcggtttgac
cggaagatcctcgtccccttcccccccgaggccccgggaagcggggtcggggaggcctgg
gtgggggtggcctggtaccggaaggtcctgcgggccaagccccggccgggacggcggctt
ttcctccgcttcggggccgtggactaccgggcggaggtcttcgtgaacggggtgcgggtc
ctggagcacgagggggggcacacccccttcggcctggacctcacccccttcctggaaagg
cccgtggaggtcctggtgcgggccgaggacgaccccctggacccggaagccccccggggc
aagcaggccctgggggagcccgggggcatcttctacccccgcaccaccgggatctggcag
ccggtctggctggagtgggtgccggaaagccacatcgccgccctgcgcctcaccccggac
ctcaaggctctgggcttccacctcgaggtccaggcccatggcgagggggaggcggtggag
gtggccctcttccccggggtgagaggggaggccccccttggggaggcgccctggctggag
gcccgctttcccctcctcggggggagggcctccgggttcctcggcctccccgcgaagggg
aacccggaaggcctcctctggcggccggaaacccccgtcctcttccccttgcgcctccgc
ctcctctccgggaggcgggtcctggacgaggtctacagctacggggggctcagggaggtg
gccgcccaaaaaggggtcttcctcctcaacggggagccctacttccccaggctggtcctg
gaccaggggctctggcccgaaggccacctcgcgcccccaagcctcgccgccctccggcgg
gacgcggcgctcgccaaggccctgggcttcaacggggtgcgcaagcaccagaaggtggag
gacccccgctacctccacctggcggaccggctcggcctcctcgtcttcgcggagatgccg
agcttcttccgcttctcccccaaggcggcccggcgctacctcgccgagctcgccgaggcc
ctggagcgagaccggaaccaccccagcctggtggcctggatcctcttcaacgagggctgg
ggcctcaccccctggcgggccgagaccctggccttcctccagggggccttcctcctggcc
cgcgccctggaccccacccgcctcctcgtggacaacgacggctttgagcacgggcccttt
tgggacctcctcaccgtgcacgactacgcccctccggaggtcctggcccgtaggtacggg
gaaggcctccccgaggcccccatgggccgccccctcgccctggcgggccttcctccaggg
gtgcgccccttcctctcggagttcggagggctcaggctcaaggggccgggcccgggctgg
gggtaccgggaggcggaggacgaggaggccttcctgcgggaggcgctccgctacctggaa
accgcgtgcggaagccgcctgagcgggttctgctacacccagctctacgacaccttccag
gaggagaacggcctcctggacttctggcggaggcccaaggtgccccccgagagggtccgg
gccttcctggagggttgcgaggcgaggcggcttctcgcggagtag

DBGET integrated database retrieval system