KEGG   Thermus thermophilus HB8: TTHB034Help
Entry
TTHB034           CDS       T00220                                 

Definition
putative beta-mannosidase
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
ttj  Thermus thermophilus HB8
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ttj00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    TTHB034
  Lipid metabolism
   00600 Sphingolipid metabolism
    TTHB034
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    TTHB034
Enzymes [BR:ttj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     TTHB034
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pTT27:24908..26644
Genome map
AA seq 578 aa AA seqDB search
MRVEKAWFLADGAEAPEGLPEGGFREVALPHQWSLEGVEAEVGWYRLALPEAGPRRFLLS
FGDYYQEAWLDGTYLGRHEGYFFPWVLELPKGKELFLRVSAPKEPLGVWPRFKRQIKGVF
GQHDCRPGGTTARGQERGTGGLWGGVEVWAREEVALLGLAHRLFPRAGGWRLWVRLLVDA
QRPFRERARLFLVPANFPGEALEREAVLEGEAGRAWREVVWDLPEMPLWEVWERGFPHLF
RLEADLLGARLGVPLGFRTVEVDGEGWLLLNGKRLFLRGTNAIPTQWLAAYSEAMAQKDV
ALLKEANLNAVRVHAHVTHPAFYAACDREGVLVWQDFPLQWGYAPDEAFAQEALRQARAM
VEVLGAHPSVYLWCAQNEPTHNRHALGPLLAAALRAADPTRPVKEASDFREHPYPGWYRG
HYRDFLALPGAPLPSEFGAQALPRAELLRRVLGEAAWPPRWEVWAYHNFQPHETFRVARV
EMGESLEEFVERSQDYQARLIEFAVHAYRRAKGKVVGYFQFMFVEPWEGITWAVLDVERV
PKKGFFALKEASSPVLLSLVPYRERVEVGGPPCRRPGS
NT seq 1737 nt NT seq  +upstreamnt  +downstreamnt
atgagggtggagaaggcgtggtttctggcggatggggcagaggccccggaggggcttccc
gagggaggcttccgggaggtggccctgccccaccagtggagcctggagggggtagaggcg
gaggtgggctggtaccgcctcgccctgcccgaggcggggcccaggcgcttcctcctttcc
tttggggactactaccaggaggcctggctggacgggacctacctgggccggcacgagggc
tacttcttcccctgggtcctggagcttcccaaggggaaggagctcttcctaagggtctcc
gcccccaaggagcccctcggggtctggccccggttcaagcggcagatcaagggggtcttc
ggccagcacgactgccgccccggggggaccacggcgaggggccaggagcgggggaccggg
gggctatggggcggggtggaggtctgggcccgggaggaggtggccctcctgggcctcgcc
caccgcctcttcccccgcgctggggggtggcggctttgggtgcgccttctggtggacgcc
caaaggcccttccgcgagcgggcgcgcctctttctcgtcccggcgaacttccccggggaa
gccctggagcgggaggcggtcctcgagggggaggcggggcgggcctggcgggaggtggtc
tgggacctgccggagatgccgctttgggaggtgtgggagcggggcttcccccacctcttc
cgcctcgaggcggacctcctcggggcgaggcttggcgtccccctgggcttccgcaccgtg
gaggtggacggagagggctggctccttctgaacgggaagcggctcttcctgcgggggacc
aacgccatccccacccagtggctcgccgcctactccgaggcgatggcccaaaaggacgtg
gccctcctcaaggaggcgaacctgaacgccgtgcgggtccacgcccacgtgacccacccc
gccttctacgcggcctgcgaccgggaaggggtcctggtctggcaggacttccccctgcag
tggggctacgccccggacgaggccttcgcccaggaggccctgcgccaggcccgggccatg
gtggaggtcctgggggcccaccccagcgtctacctctggtgcgcccagaacgagcccacc
cacaaccgccacgccctgggccccctcctcgccgcggcgctaagggcggcggaccccacc
cggcccgtgaaggaggcctcggacttccgcgagcacccctaccccggctggtaccggggg
cattaccgggacttcctcgccctccccggggcccccctcccctcggagttcggggcccag
gccctgccccgggcggagctcctaaggcgggtcctgggggaggccgcctggcccccaagg
tgggaggtctgggcctaccacaacttccagccccacgagaccttccgggtagccagggtg
gagatgggggaaagccttgaggagttcgtggagcgctcccaggactaccaggcgaggctt
atagagttcgccgtccacgcctaccggagggccaaggggaaggtggtgggctacttccag
ttcatgttcgtggagccttgggaggggatcacctgggcggttttggacgtggagcgggtt
cccaagaagggcttcttcgccctgaaggaggccagcagccccgtcctcctctccctggtg
ccctaccgggagagggtggaggtgggcggccccccttgcaggaggcctggctcgtaa

DBGET integrated database retrieval system