KEGG   Thermus thermophilus HB8: TTHB142Help
Entry
TTHB142           CDS       T00220                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
ttj  Thermus thermophilus HB8
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:ttj00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
pTT27:128207..129694
Genome map
AA seq 495 aa AA seqDB search
MAFLLALDQGTTSSRAILFTLEGRPVAVAKREFRQLYPKPGWVEHDPLEIWETTLWAARE
VLRRAGAEAGEVLALGITNQRETTLLWDRKTGKPLHNAIVWQDRRTTPLCEALRAKGLEP
LFRERTGLLFDPYFSGTKLVWLLENVPGLKARAEGGGVAFGTVDTWLIWNLTGGKVHATD
PTNASRTLLFNLHTLAWDPELLEALGIPAALLPEVRPSDGDFGETLPELLGAPVPIRGVL
GDQQAALFGQAALGGGEGKCTYGTGAFLLLNTGKRPVLSEKGLLATVAWSLGGRATYALE
GSLFVAGAAVGWLKEVGLIRESAEVEALAASVEDTGDVYFVPAFTGLGAPYWDPYARGTL
LGLTRGTSRAHLARAALEGVAFQVRDVVLAMEEEAGVRLKVLKADGGMAQNRLFLKIQAD
LLGVPVAVPEVTETTALGAALMAGVGAGALSPEDVAGRFREAERFLPTMPEGRREALYRR
WREAVERAKGWAREG
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
gtggcgtttctcttggctttggaccagggcaccaccagcagccgggccatcctcttcacc
ctggaggggaggcccgtggcggtggccaagcgggagttccggcagctttacccgaaaccc
gggtgggtggagcacgaccccctggagatctgggagaccaccctttgggcggcgcgggag
gttctcaggagggccggggcggaggcaggggaggtcctggccctggggatcacgaaccag
cgggagaccaccctcctctgggaccggaagacggggaagcccctccacaacgccatcgtc
tggcaggaccggaggacgacccccctgtgcgaggccttgagggcaaagggcctcgagccc
ttgttccgggagaggaccgggctcctctttgacccctacttctcggggacgaagctcgtg
tggcttctggagaacgtgcccggcctaaaggcgcgagcggaggggggcggggtggccttc
ggcaccgtggacacctggctcatctggaacctcacgggggggaaggtccacgccaccgac
cccacgaacgcgagccgcaccctgctcttcaacctccacaccctcgcctgggacccggag
cttcttgaggccctagggatccccgccgccctcctcccggaggtgcggccctcggacggg
gacttcggggaaaccctccccgagcttttgggggcgcccgtccccatacggggggtcttg
ggggaccagcaggcggccctcttcggccaggcggccctaggagggggggaggggaagtgc
acctacggcaccggggccttcctcctcctgaacacggggaaaaggcccgtcctctcggaa
aagggcctcctcgccacggtggcctggagccttggggggagggccacctacgccctcgag
gggagcctcttcgtggcgggggccgcggtggggtggctcaaggaggtgggcctcatccgg
gaaagcgccgaggtggaggccctggcggcaagcgtggaggacacgggggacgtctacttc
gtccccgccttcaccgggcttggcgccccctactgggacccctacgcccggggaaccctc
ctcggcctcacccgggggacgagccgggcccacctggcccgggcggccctggagggggtg
gccttccaggtgcgggacgtggtcctggccatggaggaggaggccggggtccggctcaag
gtcctcaaggcggacgggggcatggcgcaaaaccgcctcttcctcaagatccaggcggac
ctcctcggggtgcccgtggcggtgccggaggtgacggagaccaccgccttgggggcggcc
ctcatggccggggtgggggcgggggccctttccccggaggacgtggcggggcgcttccgc
gaggcggagaggttcctccccacgatgcccgaagggaggcgggaggccctctaccggagg
tggcgggaggcggtggaaagggccaagggctgggccagggaggggtag

DBGET integrated database retrieval system