KEGG   Thermus thermophilus HB8: TTHB247Help
Entry
TTHB247           CDS       T00220                                 

Definition
acetaldehyde dehydrogenase (EC:1.2.1.10)
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
ttj  Thermus thermophilus HB8
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ttj00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    TTHB247
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    TTHB247
   00650 Butanoate metabolism
    TTHB247
  Amino acid metabolism
   00360 Phenylalanine metabolism
    TTHB247
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    TTHB247
   00622 Xylene degradation
    TTHB247
   00621 Dioxin degradation
    TTHB247
Enzymes [BR:ttj01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     TTHB247
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pTT27:complement(251774..252697)
Genome map
AA seq 307 aa AA seqDB search
MSERVKVAILGSGNIGTDLMYKLLKNPGHMELVAVVGIDPKSEGLARARALGLEASHEGI
AYILERPEIKIVFDATSAKAHVRHAKLLREAGKIAIDLTPAARGPYVVPPVNLKEHLDKD
NVNLITCGGQATIPLVYAVHRVAPVLYAEMVSTVASRSAGPGTRQNIDEFTFTTARGLEA
IGGAKKGKAIIILNPAEPPILMTNTVRCIPEDEGFDREAVVASVRAMEREVQAYVPGYRL
KADPVFERLPTPWGERTVVSMLLEVEGAGDYLPKYAGNLDIMTASARRVGEVFAQHLLGK
PVEEVVA
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaaagggttaaggtagccatcctgggctccggcaacatcgggacggacctgatg
tacaagctcctgaagaacccgggccacatggagcttgtggcggtggtggggatagacccc
aagtccgagggcctggcccgggcgcgggccttagggttagaggcgagccacgaagggatc
gcctacatcctggagaggccggagatcaagatcgtctttgacgccaccagcgccaaggcc
cacgtgcgccacgccaagctcctgagggaggcggggaagatcgccatagacctcacgccg
gcggcccggggcccttacgtggtgcccccggtgaacctgaaggaacacctggacaaggac
aacgtgaacctcatcacctgcggggggcaggccaccatccccctggtctacgcggtgcac
cgggtggcccccgtgctctacgcggagatggtctccacggtggcctcccgctccgcgggc
cccggcacccggcagaacatcgacgagttcaccttcaccaccgcccggggcctggaggcc
atcgggggggccaagaaggggaaggccatcatcatcctgaacccggcggaaccccccatc
ctcatgaccaacaccgtgcgctgcatccccgaggacgagggctttgaccgggaggccgtg
gtggcgagcgtccgggccatggagcgggaggtccaggcctacgtgcccggctaccgcctg
aaggcggacccggtgtttgagaggcttcccaccccctggggggagcgcaccgtggtctcc
atgctcctggaggtggagggggcgggggactatttgcccaaatacgccggcaacctggac
atcatgacggcttctgcccggagggtgggggaggtcttcgcccagcacctcctggggaag
cccgtggaggaggtggtggcgtga

DBGET integrated database retrieval system