KEGG   Thermus thermophilus JL-18: TtJL18_0090Help
Entry
TtJL18_0090       CDS       T02009                                 

Definition
transcriptional regulator/sugar kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
ttl  Thermus thermophilus JL-18
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ttl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TtJL18_0090
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TtJL18_0090
   00052 Galactose metabolism
    TtJL18_0090
   00500 Starch and sucrose metabolism
    TtJL18_0090
   00520 Amino sugar and nucleotide sugar metabolism
    TtJL18_0090
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    TtJL18_0090
   00524 Butirosin and neomycin biosynthesis
    TtJL18_0090
Enzymes [BR:ttl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     TtJL18_0090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(82123..83031)
Genome map
AA seq 302 aa AA seqDB search
MKVVGLDLGGTKIAAGVFDGKRLLSKVVVPTPKEGGERVAEALAEAAERAEREAGVRGEA
IGLGTPGPLDFRRGVIRFAPNIPGVQDFPIRRILEEATGRPVFLENDANAAALAEHHLGA
AQGEESSLYLTVSTGIGGGVVLGGRVLRGERGQGGELGHLTLLPGGPACGCGLEGCLEAL
AAGRALERDATYAFQRPVDTRELFRLFREKDPKAERLVLQAARYVGIGLASLVKAFDPGV
VVLGGGVALNAPEGYWEALLAAYRHYLQGWEAPPLRKARLGAEAGLLGAALTAYLEVKDG
SG
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
gtgaaggtggtgggcctggacctgggcggcaccaagatcgccgccggcgtctttgacgga
aagaggctcctctccaaggtggtcgtccccacgcccaaggagggcggggagcgggtggcc
gaggccctggccgaggccgcggagcgggcggagagggaggcgggggtccggggggaggcc
atcggcctggggacgcccggccccctggacttccgccgcggggtgatccgcttcgccccc
aacatcccgggggtccaggacttccccatccgccggatcctggaggaggccacggggagg
cccgtcttcctggaaaacgacgccaacgccgccgctttggccgagcaccacctgggggcg
gcccagggagaggagagctccctctacctcaccgtctccacggggatcgggggcggggtg
gtcctggggggaagggtgctccggggggagcgggggcagggcggggagctcggccacctg
accctcctccccggggggcccgcctgcggctgcggactggagggctgcctcgaggccctg
gccgcaggccgcgccctggagcgggacgccacctacgccttccagcgccccgtggacacg
cgggagcttttccgcctcttccgcgagaaggaccccaaggcggagcgcctcgtcctccag
gccgcccggtacgtgggcatcggcctcgccagcctggtgaaggcctttgaccccggggtg
gtggtcctggggggcggggtggccctgaacgcccccgaggggtactgggaggccctcctt
gcggcctaccgccactacctccagggctgggaggccccccccttgcggaaagcccgcctg
ggggccgaggccgggcttctgggcgcggccctcaccgcctacctggaggtgaaggatgga
agcgggtaa

DBGET integrated database retrieval system