KEGG   Thermus thermophilus JL-18: TtJL18_0098Help
Entry
TtJL18_0098       CDS       T02009                                 

Definition
(GenBank) Holliday junction DNA helicase, RuvA subunit
  KO
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
ttl  Thermus thermophilus JL-18
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ttl00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    TtJL18_0098
Enzymes [BR:ttl01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     TtJL18_0098
DNA repair and recombination proteins [BR:ttl03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     TtJL18_0098
    RecFOR pathway proteins
     TtJL18_0098
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(87137..87712)
Genome map
AA seq 191 aa AA seqDB search
MIRYLRGLVLKKEAGGFVLLAGGVGFFLQAPTPFLQALEEGKEVGVHTHLLLKEEGLSLY
GFPDEENLALFELLLSVSGVGPKVALALLSALPPRLLARALLEGDARLLTSASGVGRRLA
ERIALELKGKVPPHLLAGEKVESEAAEEAVMALAALGFKEAQARAVVLDLLAQNPKARAQ
DLIKEALKRLR
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgatccgctacctccggggcctggtcctcaagaaggaggcgggcggcttcgtccttctc
gccgggggggtggggttcttcctccaggcccccacgcccttcctccaggccctggaggag
gggaaggaggtgggggtccacacccacctcctcctcaaggaggaggggctgtccctctac
ggcttccccgacgaggagaacctcgccctctttgaactcctcctctcggtgagcggcgtg
gggcccaaggtggccctcgccctcctctcggccctgccccctaggctcctcgcccgggcc
ctcctggagggggatgcgaggctcctcacctcggcgagcggggtggggagaaggctcgcc
gaaaggatcgccctggagctcaaggggaaggtgcccccccacctcctcgccggggagaag
gtggagagcgaggccgcggaggaggcggtgatggccctcgccgccttggggttcaaggag
gcccaggcgcgggcggtggtcctggacctcctggcccaaaaccccaaggcccgggcccag
gacctcatcaaggaggccctaaagcgcctccgctag

DBGET integrated database retrieval system