KEGG   Thermus thermophilus JL-18: TtJL18_0101Help
Entry
TtJL18_0101       CDS       T02009                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase complex dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ttl  Thermus thermophilus JL-18
Pathway
ttl00020  Citrate cycle (TCA cycle)
ttl00310  Lysine degradation
ttl01100  Metabolic pathways
ttl01110  Biosynthesis of secondary metabolites
ttl01120  Microbial metabolism in diverse environments
ttl01130  Biosynthesis of antibiotics
ttl01200  Carbon metabolism
Module
ttl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ttl_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ttl00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    TtJL18_0101
  Amino acid metabolism
   00310 Lysine degradation
    TtJL18_0101
Enzymes [BR:ttl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     TtJL18_0101
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-ProteinID: AFH38022
UniProt: H9ZNW2
Position
91252..92472
Genome map
AA seq 406 aa AA seqDB search
MQELKVPSVGESIVEVEIGAWLKKEGESFAQDEPLVELITDKATLELPAPFAGTLKQILK
KTGETARVGEAIALLEAGAAEAKPQAQAPAEAPKEPAQGPLAMPAAERLMQEKGVSPAEV
QGTGLGGRILKEDVMRHLEERAPAKPQEAPPPPPPSRPAPPPSTPTQPPADKPWRVSEAV
PMTPLRRRIAERLLMVRQTTAMLTTFNEADMSAVIALRKEFGEAFQKKYGVKLGFMSFFV
KAVVQALKEIPELNAEIRDNHIVYHRYYDIGIAVGGGEGLVVPVIRDADRLSFAEIERQI
ADFAERARTKKLKPEELMGGTFTITNGGIYGSLNSTPLLNPPQVGILGMHAIQERPVARD
GQVVIRPMMYLALSYDHRIVDGREAVTFLRRVKELIENPARLLLEV
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
gtgcaggaactcaaggtgccctccgtgggcgaaagcatcgtggaagtggagatcggcgct
tggctcaagaaggaaggggaaagcttcgcccaggacgagcccttggtggagctcatcacc
gacaaggccaccctggagctccccgcccccttcgccggtaccctgaagcagatcctgaag
aagaccggggagaccgcccgggtgggggaggccatcgcccttctcgaggcgggggcggcg
gaggcgaagccccaggcccaggcccccgccgaggcccccaaggagcccgcccaagggccc
ctggccatgcccgctgcggagcgcctcatgcaggaaaagggcgtctccccggcggaggtc
caggggacgggcctaggtgggcggatcctcaaggaggacgtgatgcgccacctggaggaa
agggcccccgccaagccccaggaggccccgccgccccctcccccctcccgccctgcgccc
ccgccctccacccccacgcagccccccgccgacaagccctggcgggtgagcgaggccgtg
cccatgacgcccttgcgccgccggatcgccgagcgcctcctcatggtccgccagaccacg
gccatgctcaccaccttcaacgaggcggacatgtcggcggtaatcgccctcaggaaggag
ttcggcgaggccttccagaagaagtacggggtcaagctcggcttcatgagcttcttcgtc
aaggccgtggtccaggccctcaaggagatccccgagctcaacgccgagatccgggacaac
cacatcgtctaccaccgctactacgacatcggcatcgccgtgggcgggggcgagggcctg
gtggtccccgtgatccgcgacgccgaccgcctctccttcgccgagattgagcggcagatc
gccgattttgccgaaagagcccgcaccaagaagctcaagcccgaggagctcatggggggc
accttcaccatcaccaacggggggatctacggctccctgaactccacccccctcctcaac
ccgccccaggtgggcatccttggcatgcacgccatccaggaaaggcccgtggcccgggac
ggccaggtggtcatccgccccatgatgtacctcgccctctcctacgaccaccgcatcgtg
gacgggcgggaggcggtgaccttcctccgccgggtgaaggagctcattgaaaacccggcc
cgcctgcttctggaggtgtag

DBGET integrated database retrieval system