KEGG   Thermus thermophilus JL-18: TtJL18_0101Help
Entry
TtJL18_0101       CDS       T02009                                 

Definition
2-oxoglutarate dehydrogenase complex dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ttl  Thermus thermophilus JL-18
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ttl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TtJL18_0101
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    TtJL18_0101
  Amino acid metabolism
   00310 Lysine degradation
    TtJL18_0101
Enzymes [BR:ttl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     TtJL18_0101
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
91252..92472
Genome map
AA seq 406 aa AA seqDB search
MQELKVPSVGESIVEVEIGAWLKKEGESFAQDEPLVELITDKATLELPAPFAGTLKQILK
KTGETARVGEAIALLEAGAAEAKPQAQAPAEAPKEPAQGPLAMPAAERLMQEKGVSPAEV
QGTGLGGRILKEDVMRHLEERAPAKPQEAPPPPPPSRPAPPPSTPTQPPADKPWRVSEAV
PMTPLRRRIAERLLMVRQTTAMLTTFNEADMSAVIALRKEFGEAFQKKYGVKLGFMSFFV
KAVVQALKEIPELNAEIRDNHIVYHRYYDIGIAVGGGEGLVVPVIRDADRLSFAEIERQI
ADFAERARTKKLKPEELMGGTFTITNGGIYGSLNSTPLLNPPQVGILGMHAIQERPVARD
GQVVIRPMMYLALSYDHRIVDGREAVTFLRRVKELIENPARLLLEV
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
gtgcaggaactcaaggtgccctccgtgggcgaaagcatcgtggaagtggagatcggcgct
tggctcaagaaggaaggggaaagcttcgcccaggacgagcccttggtggagctcatcacc
gacaaggccaccctggagctccccgcccccttcgccggtaccctgaagcagatcctgaag
aagaccggggagaccgcccgggtgggggaggccatcgcccttctcgaggcgggggcggcg
gaggcgaagccccaggcccaggcccccgccgaggcccccaaggagcccgcccaagggccc
ctggccatgcccgctgcggagcgcctcatgcaggaaaagggcgtctccccggcggaggtc
caggggacgggcctaggtgggcggatcctcaaggaggacgtgatgcgccacctggaggaa
agggcccccgccaagccccaggaggccccgccgccccctcccccctcccgccctgcgccc
ccgccctccacccccacgcagccccccgccgacaagccctggcgggtgagcgaggccgtg
cccatgacgcccttgcgccgccggatcgccgagcgcctcctcatggtccgccagaccacg
gccatgctcaccaccttcaacgaggcggacatgtcggcggtaatcgccctcaggaaggag
ttcggcgaggccttccagaagaagtacggggtcaagctcggcttcatgagcttcttcgtc
aaggccgtggtccaggccctcaaggagatccccgagctcaacgccgagatccgggacaac
cacatcgtctaccaccgctactacgacatcggcatcgccgtgggcgggggcgagggcctg
gtggtccccgtgatccgcgacgccgaccgcctctccttcgccgagattgagcggcagatc
gccgattttgccgaaagagcccgcaccaagaagctcaagcccgaggagctcatggggggc
accttcaccatcaccaacggggggatctacggctccctgaactccacccccctcctcaac
ccgccccaggtgggcatccttggcatgcacgccatccaggaaaggcccgtggcccgggac
ggccaggtggtcatccgccccatgatgtacctcgccctctcctacgaccaccgcatcgtg
gacgggcgggaggcggtgaccttcctccgccgggtgaaggagctcattgaaaacccggcc
cgcctgcttctggaggtgtag

DBGET integrated database retrieval system