KEGG   Thermus thermophilus JL-18: TtJL18_0170Help
Entry
TtJL18_0170       CDS       T02009                                 

Definition
pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase component
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ttl  Thermus thermophilus JL-18
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:ttl01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ttl00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:ttl00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:ttl00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(152889..154247)
Genome map
AA seq 452 aa AA seqDB search
MPKEILMPELAESVVEGEILKWLVEEGDYLKKDQPFVEVMTDKVTVELPSPYEGVLLKKL
AKEGEVVKVHAPIALIAEPGEAVEGVKEAPPVQAVEERSIVEPGLPEKEEKEDLSLFKPD
PTQVAVKNPFLSGEKPKEGARPQGRVLAVPAARKLARELGIPIEEVPGSGPLGRVRVEDV
RAYAERRKAAPERPEEAREALPSGFPPPPKYAPPKGYEHLEERVPLRGIRRTIAQGLWQS
HLYTVRTLNVDEADLTELVRLRERLKPQAEAQGVKLTYLPFIVKAVVRALKKFPMLNTSL
DEERQEIVYKRYYHIGLAVATERGLIVPVLRDADRKSVLEIAREIVELSQKAREGRLAPE
EVSGSTFTITNIGSVGATLSFPIIHLPDAAILGVHSIRKRPWVMPDGSIQARDIMFLSLS
FDHRLVDGAEAAMFTREVIRLLENPDLLLLEM
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgcccaaggaaatcctcatgcccgagctcgccgaaagcgtggtggaaggcgagattctg
aagtggctcgtggaggaaggggactacctgaagaaggaccagcccttcgtggaggtcatg
accgacaaggtcacggtggagctgccctccccttacgagggggtgctcctgaagaagctg
gccaaggagggggaggtggtcaaggtccacgcccccatcgccctcatcgccgagcccggc
gaggcggtggagggcgtgaaggaggcccccccggtgcaggcggtggaggagcgctccatc
gtggagcccggcctgcccgaaaaggaggagaaggaggacctctccctcttcaagcccgac
cccacgcaggtggcggtgaaaaaccccttcctctccggggagaagcccaaggaaggagcg
aggccccaaggccgggtcctggcggtgcccgccgcaaggaagctcgcccgggaactgggc
attcccattgaggaggtaccgggctcggggcccttaggccgggtccgggtggaggacgtc
cgggcctacgccgagcggaggaaggccgctcccgaaaggcccgaggaggcgcgtgaggcg
cttccttccggcttcccacccccgcccaagtacgccccgcccaaggggtacgagcacctg
gaggagcgggtgcctctaaggggcatccgccgcaccatcgcccaggggctctggcagagc
cacctctacacggtgcgtaccctcaacgtggacgaggccgacctcacggagctcgtgcgc
ctgcgcgagcgcctcaagccccaggccgaggcccagggggtcaagctcacctacctgccc
ttcatcgtcaaggcggtggtgcgggccctgaagaagttccccatgctgaacaccagcctg
gacgaggagaggcaggagatcgtctacaagcgctactaccacatcggcctcgccgtggcc
acggaaaggggcctcatcgtccccgtcctgcgggacgccgaccggaaaagcgtcctggaa
atcgcccgggagatcgtcgagctttcccagaaggcccgggaaggccgcctcgctcccgag
gaggtttcggggtccacctttaccatcaccaacatcggctccgtgggagccaccttgagc
ttccccatcatccacctgccggacgcggccatcctcggcgtgcactccataaggaagcgc
ccctgggtcatgccggacggctccatccaggcccgggacatcatgttcctctccctctcc
tttgaccaccggctggtggacggggccgaggcggctatgttcacccgggaggtcatcagg
ctcttggaaaaccccgacctgctccttctggaaatgtag

DBGET integrated database retrieval system