KEGG   Thermus thermophilus JL-18: TtJL18_0170Help
Entry
TtJL18_0170       CDS       T02009                                 

Definition
(GenBank) pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ttl  Thermus thermophilus JL-18
Pathway
ttl00010  Glycolysis / Gluconeogenesis
ttl00020  Citrate cycle (TCA cycle)
ttl00620  Pyruvate metabolism
ttl01100  Metabolic pathways
ttl01110  Biosynthesis of secondary metabolites
ttl01120  Microbial metabolism in diverse environments
ttl01130  Biosynthesis of antibiotics
ttl01200  Carbon metabolism
Module
ttl_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ttl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TtJL18_0170
   00020 Citrate cycle (TCA cycle)
    TtJL18_0170
   00620 Pyruvate metabolism
    TtJL18_0170
Enzymes [BR:ttl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     TtJL18_0170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-ProteinID: AFH38086
UniProt: H9ZP26
Structure
PDB: 

Jmol
Position
complement(152889..154247)
Genome map
AA seq 452 aa AA seqDB search
MPKEILMPELAESVVEGEILKWLVEEGDYLKKDQPFVEVMTDKVTVELPSPYEGVLLKKL
AKEGEVVKVHAPIALIAEPGEAVEGVKEAPPVQAVEERSIVEPGLPEKEEKEDLSLFKPD
PTQVAVKNPFLSGEKPKEGARPQGRVLAVPAARKLARELGIPIEEVPGSGPLGRVRVEDV
RAYAERRKAAPERPEEAREALPSGFPPPPKYAPPKGYEHLEERVPLRGIRRTIAQGLWQS
HLYTVRTLNVDEADLTELVRLRERLKPQAEAQGVKLTYLPFIVKAVVRALKKFPMLNTSL
DEERQEIVYKRYYHIGLAVATERGLIVPVLRDADRKSVLEIAREIVELSQKAREGRLAPE
EVSGSTFTITNIGSVGATLSFPIIHLPDAAILGVHSIRKRPWVMPDGSIQARDIMFLSLS
FDHRLVDGAEAAMFTREVIRLLENPDLLLLEM
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgcccaaggaaatcctcatgcccgagctcgccgaaagcgtggtggaaggcgagattctg
aagtggctcgtggaggaaggggactacctgaagaaggaccagcccttcgtggaggtcatg
accgacaaggtcacggtggagctgccctccccttacgagggggtgctcctgaagaagctg
gccaaggagggggaggtggtcaaggtccacgcccccatcgccctcatcgccgagcccggc
gaggcggtggagggcgtgaaggaggcccccccggtgcaggcggtggaggagcgctccatc
gtggagcccggcctgcccgaaaaggaggagaaggaggacctctccctcttcaagcccgac
cccacgcaggtggcggtgaaaaaccccttcctctccggggagaagcccaaggaaggagcg
aggccccaaggccgggtcctggcggtgcccgccgcaaggaagctcgcccgggaactgggc
attcccattgaggaggtaccgggctcggggcccttaggccgggtccgggtggaggacgtc
cgggcctacgccgagcggaggaaggccgctcccgaaaggcccgaggaggcgcgtgaggcg
cttccttccggcttcccacccccgcccaagtacgccccgcccaaggggtacgagcacctg
gaggagcgggtgcctctaaggggcatccgccgcaccatcgcccaggggctctggcagagc
cacctctacacggtgcgtaccctcaacgtggacgaggccgacctcacggagctcgtgcgc
ctgcgcgagcgcctcaagccccaggccgaggcccagggggtcaagctcacctacctgccc
ttcatcgtcaaggcggtggtgcgggccctgaagaagttccccatgctgaacaccagcctg
gacgaggagaggcaggagatcgtctacaagcgctactaccacatcggcctcgccgtggcc
acggaaaggggcctcatcgtccccgtcctgcgggacgccgaccggaaaagcgtcctggaa
atcgcccgggagatcgtcgagctttcccagaaggcccgggaaggccgcctcgctcccgag
gaggtttcggggtccacctttaccatcaccaacatcggctccgtgggagccaccttgagc
ttccccatcatccacctgccggacgcggccatcctcggcgtgcactccataaggaagcgc
ccctgggtcatgccggacggctccatccaggcccgggacatcatgttcctctccctctcc
tttgaccaccggctggtggacggggccgaggcggctatgttcacccgggaggtcatcagg
ctcttggaaaaccccgacctgctccttctggaaatgtag

DBGET integrated database retrieval system