KEGG   Thermus thermophilus JL-18: TtJL18_0212Help
Entry
TtJL18_0212       CDS       T02009                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
ttl  Thermus thermophilus JL-18
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ttl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    TtJL18_0212
Enzymes [BR:ttl01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     TtJL18_0212
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
191254..192099
Genome map
AA seq 281 aa AA seqDB search
MRTLWLRDRALDLDRVRLLGVLNLTPDSFSDGGRYLDPERALERAREMVAEGADILDLGA
ESTRPGAAPVPVEEEKRRLLPVLEAVLSLGVPVSVDTRKPEVAEEALKLGAHLLNDVTGL
RDERMVALAARHGVAAVVMHMPVPDPATMMAHARYRDVVAEVKAFLEAQAKRALSAGVPQ
VVLDPGFGFGKLLEHNLALLRRLDEIVALGHPVLVGLSRKRTIGELSGVEDPAQRVHGSV
AAHLFAVTKGARLLRVHDVRAHREALGVWEALYGGDRPSRA
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
gtgcggacgctctggcttcgggaccgggccctggacctggaccgggtgcggctcctgggg
gtgctgaacctcacccccgactccttctccgacgggggccggtacttggacccggagcgg
gcccttgagcgggcccgggagatggtggccgagggggcggacattctggatttgggggcc
gagtccacccgccctggggcggcgcctgtgcccgtggaggaggagaagcggaggctcctt
cccgtcctcgaggcggtcctttccctgggggtaccggtgagcgtggacacccgcaagccc
gaggtggccgaggaggccctaaagcttggggcccaccttctgaacgacgtcaccgggctt
cgggacgagcgcatggtggccctggccgcccgccacggggtggccgccgtggtcatgcac
atgccggtgccggacccggccaccatgatggcccacgcccgctaccgggatgtggtggcc
gaggtcaaggccttcctcgaggcccaggcgaaaagggccctaagcgcaggggtgccccag
gtggtcctggacccggggttcggcttcgggaagctcttggagcacaacctcgccctcctc
cgccgcctggacgagatcgtggccctgggtcacccggtcttggtggggctttcccgcaag
cgcaccatcggggagctttccggggtggaggacccggcccagagggtccacggctccgtg
gccgcccacctcttcgccgtgacgaagggggcgaggttgcttcgggtccacgacgtgcgg
gcccaccgggaggcccttggggtttgggaggcgctgtatgggggagatcgcccttctcgg
gcttga

DBGET integrated database retrieval system